Align BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized)
to candidate GFF3112 HP15_3055 high-affinity leucine-specific leucine-specific-binding periplasmic protein of high-affinity branched-chain amino acid ABC transporter transport system periplasmic binding protein
Query= TCDB::Q9L3M3 (381 letters) >FitnessBrowser__Marino:GFF3112 Length = 370 Score = 277 bits (708), Expect = 4e-79 Identities = 147/357 (41%), Positives = 214/357 (59%), Gaps = 3/357 (0%) Query: 3 KSLLSAVALTAMLAFSGNAWADVLIAVAGPLTGPNAAFGAQLQKGAEQAAADINAAGGIN 62 K L++AV+ + L +G+A A++ I +AGP+TGP A +G GA A INA GG+ Sbjct: 6 KKLVTAVSTSVALMGAGHAAAEIQIGIAGPMTGPVAQYGDMQFSGARMAIEQINANGGVM 65 Query: 63 GEQIKIELGDDVSDPKQGISVANKFAADGVKFVIGHFNSGVSIPASEVYAENGILRNHPG 122 GE++ DDV DPKQ ++VAN DGV+FVIGH S + PAS++Y + GIL P Sbjct: 66 GEELVAVEYDDVCDPKQAVTVANSLVNDGVRFVIGHLCSSSTQPASDIYEDEGILMVTPA 125 Query: 123 RDEPDLHGTGLWNTFRTCGRDDQQGAIAGKYLADHFKDAKIAVVHDKTPYGQGLADETKK 182 P++ G FRT G D QG +A +Y+A ++A+VHDK YG+G+A + Sbjct: 126 STSPEITERGYELVFRTIGLDSMQGPVAARYIASQ-NPERVAIVHDKQQYGEGIATAVRD 184 Query: 183 AMNAAGVTEVIYEGINVGDKDFSALIAKMKEAGVSIIYWGGLHTEAGLIIRQAADQGLKA 242 + AGV ++EGI GDKDFS+L+ K+K+A V +Y+GG H E GLI+RQA L A Sbjct: 185 TLKDAGVEIAMFEGITAGDKDFSSLVTKLKQADVDYVYYGGYHPELGLILRQANSADLDA 244 Query: 243 TLVSGDGIVSNELASIAGDAVAGTLNTFGPDPTANPANKELVEKFKAAGFNPEA-YTLYS 301 + +G+ + ++ +IAG+A G L T P N+ LV+ F+ G +P + L S Sbjct: 245 RFMGPEGVGNKDINTIAGEAAEGLLVTLPPAFDQKAENQALVKAFEDKGEDPSGPFVLTS 304 Query: 302 YAAMQTIAGAAKAAGSLDPEAVAKAMKEKGPFPTVLGDISFDEKGDPKIPGYIMYEW 358 Y A+Q +A +AAGS DP VA A++E G F T +G + +D+ GD K +++YEW Sbjct: 305 YTAVQLVAEGIEAAGSTDPFDVAAALRE-GTFQTPIGTVEYDKAGDMKSFEFVVYEW 360 Lambda K H 0.314 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 370 Length adjustment: 30 Effective length of query: 351 Effective length of database: 340 Effective search space: 119340 Effective search space used: 119340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory