Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF2760 HP15_2704 branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__Marino:GFF2760 Length = 252 Score = 190 bits (483), Expect = 2e-53 Identities = 108/258 (41%), Positives = 162/258 (62%), Gaps = 10/258 (3%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 L++V+ L FGG+ A+ SF + G + ++IGPNGAGKTT+FN ITG Y PT G I Sbjct: 4 LVEVKGLDKAFGGVHAVEGVSFSVEAGQVYSVIGPNGAGKTTLFNLITGLYTPTKGEILL 63 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTIL 133 N +S + L E + RTFQ +++ +T +EN+++ +H +L K+S +T Sbjct: 64 NGESTAKLEPNEL------AERGMCRTFQQMQICMNMTAIENVMLGRHLQL-KSSLFTT- 115 Query: 134 GLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELL 193 L + +R A A + A +E D D A + YGA +RLEIARA+ P+++ Sbjct: 116 -LFRLPSLRRNEAAARKRAAELMEYVGCGDYLDAEASAMSYGALKRLEIARALAAEPKVI 174 Query: 194 CLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISD 253 LDEPAAGLN E+A L L++ I A+ GT+++L+EHDM +VM ISD ++VL YG+ +++ Sbjct: 175 LLDEPAAGLNAVETAALEDLIRKI-ADQGTTVMLVEHDMKLVMGISDRLLVLNYGRVLAE 233 Query: 254 GTPDHVKNDPRVIAAYLG 271 GTP+ ++ +P VIAAYLG Sbjct: 234 GTPEEIRQNPDVIAAYLG 251 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 252 Length adjustment: 25 Effective length of query: 267 Effective length of database: 227 Effective search space: 60609 Effective search space used: 60609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory