Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate GFF3090 HP15_3033 amino acid ABC transporter, inner membrane subunit
Query= TCDB::Q88NY3 (248 letters) >FitnessBrowser__Marino:GFF3090 Length = 240 Score = 92.8 bits (229), Expect = 6e-24 Identities = 64/212 (30%), Positives = 105/212 (49%), Gaps = 8/212 (3%) Query: 25 YITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLLVQLFIW 84 Y G+ T+ + + +I LL+ L ++RTV N VSG Y LFR PLL+QL+I Sbjct: 23 YWDGMVTTVHLVFLSLVIGLLVAVPLAILRTVRNPFVSGPVWLYTYLFRGTPLLIQLYII 82 Query: 85 YFLVPDLLPEGLQE--WFKQDLNPTTSALISVVICLGLFTAARVCEQVRTGIQALPKGQE 142 Y+ + + EG+QE W++ P AL++ L TAA E +R I + P G+ Sbjct: 83 YYGLAQI--EGIQETFWWEIFREPFYPALLAFT----LNTAAYTTEIIRGAIISTPNGEI 136 Query: 143 AAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTA 202 AA+A G + ++LP A R + ++E + + S++AS++ +++L + Sbjct: 137 EAAKAYGMNWFMRMRRIVLPSAARRAVQAYSNEVIFMLHASAIASVVTIVDLTGAARNIY 196 Query: 203 EFSANLFEAFTLATLIYFTLNMGLMLLMRMVE 234 F+AF L Y L L+ R +E Sbjct: 197 SRFYAPFDAFIFVALCYMALTFILVFAFRKLE 228 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 240 Length adjustment: 24 Effective length of query: 224 Effective length of database: 216 Effective search space: 48384 Effective search space used: 48384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory