Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 1 (characterized)
to candidate GFF2244 HP15_2194 amino acid ABC transporter, permease protein
Query= reanno::pseudo3_N2E3:AO353_16280 (223 letters) >FitnessBrowser__Marino:GFF2244 Length = 362 Score = 119 bits (298), Expect = 8e-32 Identities = 64/217 (29%), Positives = 116/217 (53%), Gaps = 7/217 (3%) Query: 7 GVVQAVPGMWNGMVMTLQLTVLGVVGGIILGTLLALMRLSHSKLLSNIAGAYVNYFRSIP 66 G+ + W G+++TL L +G++ + +G LLAL R S ++ I ++ +R++P Sbjct: 143 GLEEVQSSKWGGLMLTLILAYIGIIASLPIGILLALGRRSDMPIIRGICVVFIEVWRAVP 202 Query: 67 LLLVITWFYLAVPFVLRWITGEDTPIGAFTSCIVAFMMFEAAYFCEIVRAGVQSIPKGQM 126 L+ V+ + +P L E ++ ++++AY E++R G+Q+IP+GQ Sbjct: 203 LITVLFMASVMLPLFLP----EGVNFEKLARALIGITLWQSAYMAEVIRGGLQAIPRGQY 258 Query: 127 GAAKALGMGYGQMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLNATRASG 186 AA ALG+GY + M L+ILPQA + + P ++ I LF+DT+LV +GL D L +++ Sbjct: 259 EAADALGLGYWRKMGLVILPQALKMVIPGIVNTFISLFKDTTLVLIIGLFDILGTVQSTV 318 Query: 187 DIIGRAN---EFLIIAGLVYFTISFAASRLVKRLQKR 220 N E + ++ F SR + L+++ Sbjct: 319 TDPAWQNVAIEGYVFVAFCFWVFCFGISRYSQNLERK 355 Lambda K H 0.331 0.143 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 362 Length adjustment: 26 Effective length of query: 197 Effective length of database: 336 Effective search space: 66192 Effective search space used: 66192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory