Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate GFF2210 HP15_2164 ATP-binding protein of sugar ABC transporter
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__Marino:GFF2210 Length = 364 Score = 316 bits (810), Expect = 5e-91 Identities = 167/357 (46%), Positives = 223/357 (62%) Query: 2 LELRNAAKMVGADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFD 61 L L N ++ V +I +L E G+ NVLLG TLAGKTSLMRLMAGLD+P G + ++ Sbjct: 3 LTLENLSREVDGVDYIRDANLTFEAGSFNVLLGRTLAGKTSLMRLMAGLDKPDNGRLIYN 62 Query: 62 GTDVTGMPVQKRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKL 121 G DVTG VQ RN++M+YQQFINYP LTVY NIASP+R++ + IDR V++ A +L++ Sbjct: 63 GEDVTGQSVQNRNISMIYQQFINYPNLTVYENIASPLRLAKMTESEIDRRVKETASMLRI 122 Query: 122 TPYLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQS 181 P L R PL LSGGQQQRTA+ARALVK+A+LVL DEPL NLDYKLREELR EL +F + Sbjct: 123 DPLLKRYPLELSGGQQQRTAMARALVKDATLVLFDEPLVNLDYKLREELRAELRDLFRER 182 Query: 182 GAIFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLD 241 I VYATTE +EAL LGG T L++G+V Q GP ++VYR PVN A +F++PP+N + Sbjct: 183 QCIAVYATTEANEALALGGTTTLLHEGQVVQTGPVMDVYRAPVNTLAAQLFSEPPMNMIR 242 Query: 242 VTKSGNVFTRPSGVTIPVPSHLAVVPDGPVTIAFHPHHLGLAPQTGDAARLQARTLVSEI 301 S T + LA + G P H+GL P + D + +SEI Sbjct: 243 GRVSETEVTFDEYSHHALTQELAKLKPGDYWFGIRPSHIGLVPTSDDDLEMSMEVELSEI 302 Query: 302 TGSESFVHLEYDGVRWVMLAHGIHDIDPDMEVEAFLDTRHLMAFGSDGRAIAAAGKV 358 +GSE+F+H+E V+ G+H ++ +L L F +D + + +V Sbjct: 303 SGSETFMHVENSHFEMVLQLMGVHQYHTGSPIKVYLPINKLFVFDNDEQLVHTPSQV 359 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 364 Length adjustment: 29 Effective length of query: 329 Effective length of database: 335 Effective search space: 110215 Effective search space used: 110215 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory