Align ABC transporter related (characterized, see rationale)
to candidate GFF2243 HP15_2193 amino-acid ABC transporter ATP-binding protein-like protein
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__Marino:GFF2243 Length = 256 Score = 227 bits (579), Expect = 2e-64 Identities = 123/255 (48%), Positives = 163/255 (63%), Gaps = 14/255 (5%) Query: 6 PVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSV 65 P + V+ +HK +GD HVLK ++L QG+ I I G SGSGKSTF+RC+N LE G + Sbjct: 13 PGIIRVEGMHKWYGDFHVLKDLNLTVDQGERIVICGPSGSGKSTFIRCINRLEEHQQGKI 72 Query: 66 SLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQK 125 + G EL D R +D VR ++GMVFQ+FNL+ H+TVLEN P+ V+K Sbjct: 73 IVDGIELT-----------DDVRHIDTVRREVGMVFQHFNLFPHLTVLENCCLSPIWVRK 121 Query: 126 RSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSAL 185 R E+ A L +V + ++ +P LSGGQQQRVAIARAL M PK+MLFDEPTSAL Sbjct: 122 TPRKEAEASAMEYLERVKIPDQANKFPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSAL 181 Query: 186 DPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFV-- 243 DPE++ EVL VM LA G TML VTHEMGFA+ V++RV+F+ G++ P E F Sbjct: 182 DPEMIKEVLDVMIELAGSGMTMLCVTHEMGFAKTVADRVIFMDGGEIVEQAPPHEFFTNP 241 Query: 244 -ECKSDRFRQFVSSH 257 E ++ +F Q + +H Sbjct: 242 QEARTQKFLQQILAH 256 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 256 Length adjustment: 24 Effective length of query: 239 Effective length of database: 232 Effective search space: 55448 Effective search space used: 55448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory