Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate GFF2243 HP15_2193 amino-acid ABC transporter ATP-binding protein-like protein
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Marino:GFF2243 Length = 256 Score = 238 bits (608), Expect = 7e-68 Identities = 124/242 (51%), Positives = 169/242 (69%), Gaps = 3/242 (1%) Query: 8 LISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEV 67 +I + + K +G VL+ + + + I I GPSG GKSTF+RC+NRLE G++ V Sbjct: 15 IIRVEGMHKWYGDFHVLKDLNLTVDQGERIVICGPSGSGKSTFIRCINRLEEHQQGKIIV 74 Query: 68 AGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKDRA 127 G++L+ D +H+ +R VGMVFQHFNLFPHLTVL+N L+P V + P EA+ A Sbjct: 75 DGIELTD---DVRHIDTVRREVGMVFQHFNLFPHLTVLENCCLSPIWVRKTPRKEAEASA 131 Query: 128 LTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVLN 187 + YL++V + +A+ +P QLSGGQ+QRVAIAR LCMKP+I+LFDEPTSALDPE++ EVL+ Sbjct: 132 MEYLERVKIPDQANKFPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMIKEVLD 191 Query: 188 VMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRAFLS 247 VM +LA GMTM VTHEM FA+ V++RV F + G I E+ P+E F NP+ R + FL Sbjct: 192 VMIELAGSGMTMLCVTHEMGFAKTVADRVIFMDGGEIVEQAPPHEFFTNPQEARTQKFLQ 251 Query: 248 RI 249 +I Sbjct: 252 QI 253 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 256 Length adjustment: 24 Effective length of query: 228 Effective length of database: 232 Effective search space: 52896 Effective search space used: 52896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory