Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate GFF2976 HP15_2920 amino acid ABC transporter, ATP-binding protein
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Marino:GFF2976 Length = 248 Score = 263 bits (672), Expect = 3e-75 Identities = 131/242 (54%), Positives = 176/242 (72%) Query: 8 LISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEV 67 ++ + K FG L VL+ + + +V+ IIG SG GKST +RC+N LE G LEV Sbjct: 4 IVKMKGMNKYFGKLHVLKDIDLTVEQGEVVVIIGASGSGKSTLIRCVNGLEEYESGTLEV 63 Query: 68 AGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKDRA 127 G L+ + K L ++R VGMVFQ FNLFPHLTV +N++LAP+KV P A A Sbjct: 64 DGQQLAPKSGNPKALAEIRKEVGMVFQQFNLFPHLTVKRNIMLAPKKVKETPETVANATA 123 Query: 128 LTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVLN 187 L++VG+G +AD YP QLSGGQ+QRVAIAR L M+P ++LFDEPTSALDPE++GEVL+ Sbjct: 124 ERLLNRVGIGNQADKYPSQLSGGQQQRVAIARALAMEPRLMLFDEPTSALDPEMIGEVLD 183 Query: 188 VMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRAFLS 247 VM++LA+EGMTM VVTHEM FAREV++RV + ++G I E+G P++VF NP+++R +AFLS Sbjct: 184 VMRELAKEGMTMMVVTHEMGFAREVADRVIYIHEGAIVEQGKPDDVFDNPQNERTQAFLS 243 Query: 248 RI 249 R+ Sbjct: 244 RV 245 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 248 Length adjustment: 24 Effective length of query: 228 Effective length of database: 224 Effective search space: 51072 Effective search space used: 51072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory