Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate GFF3114 HP15_3057 leucine/isoleucine/valine transporter permease subunit
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__Marino:GFF3114 Length = 423 Score = 338 bits (868), Expect = 2e-97 Identities = 179/305 (58%), Positives = 221/305 (72%), Gaps = 18/305 (5%) Query: 142 ILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGLSFWVLLPLSGIFAAL 201 +LIY+MLA GLN+VVGLAGLLDLGYVAFYAVGAY++ALLS Y G+SFW+ LP+ + AAL Sbjct: 122 VLIYIMLALGLNVVVGLAGLLDLGYVAFYAVGAYTFALLSQYTGISFWLALPIGALLAAL 181 Query: 202 WGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINWTDVTKGTFGISSIPKATLFGIPF-- 259 +G++LGFPVLRLRGDYLAIVTL FGEIIR++L NWT +T G GI IP TLFG+ F Sbjct: 182 FGLVLGFPVLRLRGDYLAIVTLGFGEIIRILLNNWTTLTGGPNGIGGIPDPTLFGMEFGR 241 Query: 260 ---DATAGGFAKLFHLPISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAWEALRED 316 + F + F + S + IFL+ + L L + TA V R RMP+GRAWEALRED Sbjct: 242 RVKEEGNTSFHETFGIAYSGEHKVIFLYLIALVLAVFTALVIRRFMRMPVGRAWEALRED 301 Query: 317 EIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILAIVVLG 376 EIA RSLG++ KL+AF GA FAGFAG+ FA++QGF+SPESFVFLESA+ILAIVVLG Sbjct: 302 EIAARSLGLSRTAVKLSAFTIGAFFAGFAGTVFASKQGFISPESFVFLESAIILAIVVLG 361 Query: 377 GMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDFTPELYRMLIFGLAMVVVMLFKPRG 436 GMGS G+ +AAI + EL RE S YRMLIFG AMV++M+++P+G Sbjct: 362 GMGSQIGVVLAAIAVTILPELAREFS-------------EYRMLIFGAAMVLMMVWRPQG 408 Query: 437 FVGSR 441 + R Sbjct: 409 LMPMR 413 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 638 Number of extensions: 41 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 423 Length adjustment: 32 Effective length of query: 431 Effective length of database: 391 Effective search space: 168521 Effective search space used: 168521 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory