Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate GFF2974 HP15_2918 glutamine ABC transporter, periplasmic glutamine-binding protein
Query= TCDB::Q9HU31 (250 letters) >FitnessBrowser__Marino:GFF2974 Length = 252 Score = 121 bits (304), Expect = 1e-32 Identities = 74/245 (30%), Positives = 131/245 (53%), Gaps = 16/245 (6%) Query: 9 LAAAATLAFALDASAADKLRIGTEGAYPPFNGIDA-SGQAVGFDLDIGKALCAKMKTECE 67 ++A+ L A +A+ LR+ T+ ++ PF +D +G+ +GFD++I + + + E + Sbjct: 9 VSASLALTVAAGTVSAETLRVVTDPSFVPFEMMDQETGEMIGFDMEIIREVADRAGFEID 68 Query: 68 VVTSDWDGIIPALNAKKFDFIVASMSITDERKQAVDFTDPYYTNKLQFVAPKSVDFKTDK 127 + T D++GIIPAL D +A ++IT+ER++ VDF+DPYY + L+ + + D ++ Sbjct: 69 LNTMDFNGIIPALQTGNVDIAIAGITITEEREEIVDFSDPYYDSGLRILVREGNDDVSEF 128 Query: 128 DSLKGKVIGAQRATIAGTWLEDNMADVVTIKLYDTQENAYLDLSSGRLDGVLADKFVQYD 187 D L+GK IG + + + +L N+ + Y + Y+ L S +D V D Sbjct: 129 DDLEGKKIGTKIGSTSYDYLVKNLDADDGVTPYPGSSDMYMALMSRAIDAVFYD------ 182 Query: 188 WLKSDAGKEFEFKGE-------PVFDNDKIGIAVRKGDPLREKLNAALKEIVADGTYKKI 240 + G KGE P+++ + GIA++ G + +N AL + DGTYK I Sbjct: 183 --APNVGYFARTKGEGKVTTVGPLYEGQQYGIALKSGSEWVDDVNEALAAMKEDGTYKTI 240 Query: 241 NDKYF 245 +K+F Sbjct: 241 YEKWF 245 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 252 Length adjustment: 24 Effective length of query: 226 Effective length of database: 228 Effective search space: 51528 Effective search space used: 51528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory