Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate GFF2243 HP15_2193 amino-acid ABC transporter ATP-binding protein-like protein
Query= TCDB::Q9HU32 (257 letters) >FitnessBrowser__Marino:GFF2243 Length = 256 Score = 230 bits (587), Expect = 2e-65 Identities = 121/246 (49%), Positives = 162/246 (65%), Gaps = 11/246 (4%) Query: 8 LEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQILVS 67 + + +HK YGD VLK ++LT G+ I I G SGSGKSTF+RCIN LE QG+I+V Sbjct: 16 IRVEGMHKWYGDFHVLKDLNLTVDQGERIVICGPSGSGKSTFIRCINRLEEHQQGKIIVD 75 Query: 68 GEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVLGKSK 127 G EL D + I+ +R E+G VFQ+FNL+PH+++L+N +P V + Sbjct: 76 GIEL-----------TDDVRHIDTVRREVGMVFQHFNLFPHLTVLENCCLSPIWVRKTPR 124 Query: 128 AEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSALDPE 187 EA A L +V I D+ + +P QLSGGQQQR AIAR L M+PK++LFDEPTSALDPE Sbjct: 125 KEAEASAMEYLERVKIPDQANKFPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPE 184 Query: 188 MVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFENPQSA 247 M++EVL+V+ LA G TML VTHEM FA+ V+ V+F+ G + EQ P + F NPQ A Sbjct: 185 MIKEVLDVMIELAGSGMTMLCVTHEMGFAKTVADRVIFMDGGEIVEQAPPHEFFTNPQEA 244 Query: 248 RCKQFM 253 R ++F+ Sbjct: 245 RTQKFL 250 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 256 Length adjustment: 24 Effective length of query: 233 Effective length of database: 232 Effective search space: 54056 Effective search space used: 54056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory