Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate GFF3963 HP15_3903 methionine import ATP-binding protein MetN 2
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__Marino:GFF3963 Length = 310 Score = 171 bits (432), Expect = 2e-47 Identities = 97/218 (44%), Positives = 134/218 (61%), Gaps = 2/218 (0%) Query: 53 LSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKI 112 ++I TGE+F I+G SG+GKSTLVR N L PT G IL+D E+I D LR FRR K+ Sbjct: 1 MTIETGEVFGIVGHSGAGKSTLVRLINLLEPPTGGRILIDDENITDYDAAELRAFRR-KV 59 Query: 113 SMVFQSFGLLPHKSVLDNVAYGLKVRG-ESKQVCAERALHWINTVGLKGYENKYPHQLSG 171 M+FQ F LL K+V DN+A+ +K+ G SK +R + V L + NKYP QLSG Sbjct: 60 GMIFQHFNLLSSKTVADNIAFPMKLAGIYSKTEIRDRVEELLARVSLTDHANKYPSQLSG 119 Query: 172 GMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDE 231 G +QRVG+ARALA I+L DEA SALDP + L ++ + L TIV ITH++D Sbjct: 120 GQKQRVGIARALACRPTILLCDEATSALDPQTTQSVLKLLADINRELGLTIVLITHEMDV 179 Query: 232 AVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 R+ +R+A++ G+++++G E+ P FV Sbjct: 180 VRRVCDRVAVMDAGEVVEMGPVSEVFLHPKHPTTRDFV 217 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 310 Length adjustment: 26 Effective length of query: 250 Effective length of database: 284 Effective search space: 71000 Effective search space used: 71000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory