Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate GFF947 HP15_926 branched-chain amino acid ABC transporter, ATP-binding protein
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Marino:GFF947 Length = 267 Score = 165 bits (417), Expect = 1e-45 Identities = 94/251 (37%), Positives = 143/251 (56%), Gaps = 6/251 (2%) Query: 15 ESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGE 74 E +L + L K F G AVD ++ V++G I LIGPNGAGKTT+FNLL+ F+ P +G+ Sbjct: 3 EQYVLETRNLVKEFKGFVAVDDVNLKVQKGHIHALIGPNGAGKTTVFNLLTKFLIPTRGQ 62 Query: 75 VLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFR 134 +LF I + IA +G VR+FQ++ V +T LEN+ +A Q G F +F Sbjct: 63 ILFKDQDITTMKSAAIARQGIVRSFQISAVFPHMTALENIRVALQTFEGTSF-----SFW 117 Query: 135 RVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPA 194 + ++ M +L++VGL A L+ G+++ LE+A L P+L+LLDEP Sbjct: 118 KSGNSLHKLNQRCMELLDAVGLAEFANTTTVELAYGRKRALELATTLAMEPQLLLLDEPT 177 Query: 195 AGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQ 254 G+ + ++ E +V +G T L++EHN+ V+ LC + VLA+G L +G + Sbjct: 178 QGMGSEDVDRVVE-LVRKAAEGRTVLMVEHNLSVVSKLCDRITVLAQGAVLTEGDYATVS 236 Query: 255 SDPRVLEAYLG 265 DPRV E Y+G Sbjct: 237 GDPRVREVYMG 247 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory