Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate GFF3116 HP15_3059 high-affinity branched-chain amino acid ABC transporter, ATP-binding protein
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Marino:GFF3116 Length = 233 Score = 207 bits (527), Expect = 1e-58 Identities = 107/233 (45%), Positives = 155/233 (66%), Gaps = 2/233 (0%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 +LV++DV Y + L G++ + GE+V++IG NGAGK+TL T+ G S G I Sbjct: 1 MLVLEDVHTHY-GKIEALHGVSVEVKKGEIVSLIGANGAGKTTLLMTVCGNPRASSGRIF 59 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLH-QGPTQTLKDRIYTM 122 +G IT + QI+R G+ VP+ VF LTV ENL MG F + + + ++ +Y + Sbjct: 60 LEGREITNESTAQIMRSGIAIVPEGRRVFSGLTVEENLHMGGFFNTKAEIRKSQEHVYEL 119 Query: 123 FPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAI 182 FP+L +R +QRAGT+SGGE+QMLA+GRALM P++++LDEPS L+P+++K +F I + Sbjct: 120 FPRLKEREHQRAGTMSGGEQQMLAIGRALMSRPEMIILDEPSLGLAPLIIKQIFEIIGQL 179 Query: 183 NATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLG 235 G + LVEQNA QAL +ADRGYVLE G+ +L +G++LLN+P V YLG Sbjct: 180 REEGITVFLVEQNAHQALNLADRGYVLETGKIRLHDTGKNLLNNPDVQNAYLG 232 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 233 Length adjustment: 23 Effective length of query: 217 Effective length of database: 210 Effective search space: 45570 Effective search space used: 45570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory