Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate GFF56 HP15_56 acyl-CoA dehydrogenase domain protein
Query= reanno::MR1:200844 (385 letters) >FitnessBrowser__Marino:GFF56 Length = 374 Score = 223 bits (569), Expect = 5e-63 Identities = 126/373 (33%), Positives = 205/373 (54%), Gaps = 4/373 (1%) Query: 5 FNEDQRQFAELARQFATDELAPFAAKWDEEHHFPKDVIQKAGELGFCSLYSPESEGGMGL 64 F ED F E AR+F E+ P +W++ PK++ +KAGE+G PE GG G Sbjct: 5 FREDHNMFREQARRFIEREICPHLEEWEKSGIVPKEIWRKAGEMGLLCSTVPEEYGGAGG 64 Query: 65 SRLDASIIFEELSKGCTATTAMLTIHNMATWMVTTWGTETLRQAWSEPLTTGQMLASYCL 124 ++++ EEL++ T + + +GTE +Q W + +G+++ + Sbjct: 65 DFGHSAVMIEELARVNATAIGFTTHSEIVAPYIVAYGTEEQKQKWLPRMVSGEIIGVIAM 124 Query: 125 TEPGAGSDAASLQTKAVPDGDEYVVSGSKMFISGAGSTELLVVMCRTGQAGPKGISAIAI 184 +EPG GSD S++T+ DGD+Y++SG K FI+ G+ +L+V + A K ++ + + Sbjct: 125 SEPGIGSDLRSMRTQLRRDGDQYIISGQKTFITNGGNADLVVTATKVDPAS-KDLTLVCV 183 Query: 185 PADSEGIIYGKAEDKMGWNAQPTRLVTFDNVRVPVANLLGEEGQGFTFAMKGLDGGRINI 244 D +G G+ DK+G Q T + FD+VRVPV+N LGEE +GF + L R+ I Sbjct: 184 ETDRDGFAKGRLLDKIGLKGQDTAELFFDDVRVPVSNRLGEENEGFGYLTHQLAWERLII 243 Query: 245 ATCSVGTAQAALERASQYMNERQQFGKPLAAFQALQFKLADMATELVAARQMVRLAAFKL 304 A + + + L+ Y ER+ FGK + FQ +FKLA++ + R V ++ Sbjct: 244 AIRAAESIDSFLDMTIGYTKERKVFGKTVFDFQNTRFKLAEIKAQATMLRVFVDNCLERV 303 Query: 305 DSGD-PEGTAYCAMAKRFATDVGFQVCDAALQIHGGYGYIREYPLERHFRDVRVHQILEG 363 + D P A AMAK +++ ++ D LQ+HGGYG++ EY + + + D RV +I G Sbjct: 304 MNNDLPADVA--AMAKLMGSELQGKLLDEMLQLHGGYGFMSEYRIGQAWIDARVARIYGG 361 Query: 364 TNEIMRLIIARRL 376 T+EIM+ II+R+L Sbjct: 362 TSEIMKEIISRKL 374 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 374 Length adjustment: 30 Effective length of query: 355 Effective length of database: 344 Effective search space: 122120 Effective search space used: 122120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory