Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate GFF1560 HP15_1522 dihydrolipoamide acetyltransferase
Query= curated2:P37942 (424 letters) >FitnessBrowser__Marino:GFF1560 Length = 409 Score = 234 bits (598), Expect = 3e-66 Identities = 144/415 (34%), Positives = 231/415 (55%), Gaps = 22/415 (5%) Query: 5 QMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELVGEE 64 ++ P ESV EGT++ W PG+ ++ + I ++ TDKV EV + G I E++ E Sbjct: 4 EIKAPVFPESVAEGTVATWHKQPGEACSRDELIVDIETDKVVLEVVAPADGVIEEIIKNE 63 Query: 65 GQTLQVGEMICKIETEGAN----PAEQKQEQPAASEAAENPVAKSAGAADQPNKKRYSPA 120 G T++ GE++ K + EGA PAE K+E+ + E A AKS ++ + SPA Sbjct: 64 GDTVESGEVVGKFK-EGAKGESKPAEGKKEE--SKEEAPKEEAKSEASSGEAI---LSPA 117 Query: 121 VLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSASKPE 180 +LA E+ +D + + GTG GR+T++D+Q +++ AAP P +A PE Sbjct: 118 ARKLAEENNVDPNSIKGTGKDGRVTKEDVQNHVDSA------KSSGGAAAPQP-AAGMPE 170 Query: 181 PKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYRNSIKD 240 + +K +P+T +R +IA + ++ T EV++ ++ R +D Sbjct: 171 ----VNVSQGERPEKRVPMTRLRASIAKRLVNAQQSAAMLTTFNEVNMGPIMEMRKQYQD 226 Query: 241 SFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATEDSLFVP 300 SF K G L F +FF KA +ALK FP +N+ G+ ++ +I +AV+T+ L VP Sbjct: 227 SFVKRHGIKLGFMSFFTKAATEALKRFPAVNASIDGNDMVYHGYQDIGVAVSTDRGLVVP 286 Query: 301 VIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGSVQSMGIINYPQ 360 V++++D + I K I K ++GKL +DM GGTFT+ N G FGS+ S I+N PQ Sbjct: 287 VLRDSDAMGLADIEKKIVEYGTKAKEGKLAIEDMTGGTFTITNGGIFGSLISTPILNPPQ 346 Query: 361 AAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILE 415 AIL + I +RP+ + NG + ++ M+ L LS DHR++DG +FL +K++LE Sbjct: 347 TAILGMHKIQERPMAV-NGKVEIQPMMYLALSYDHRMIDGKEAVQFLVAIKEMLE 400 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 409 Length adjustment: 31 Effective length of query: 393 Effective length of database: 378 Effective search space: 148554 Effective search space used: 148554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory