GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdC in Marinobacter adhaerens HP15

Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate GFF3102 HP15_3045 pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase

Query= reanno::Smeli:SMc03203
         (426 letters)



>lcl|FitnessBrowser__Marino:GFF3102 HP15_3045 pyruvate dehydrogenase
           complex, E2 component, dihydrolipoamide
           acetyltransferase
          Length = 554

 Score =  261 bits (668), Expect = 3e-74
 Identities = 156/427 (36%), Positives = 232/427 (54%), Gaps = 23/427 (5%)

Query: 6   IKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVG 65
           +K+P + +G     ++E +V  GD +  D  L  V +DKAT+EIPSP +GKV  +    G
Sbjct: 127 VKVPAL-DGFDNVPVIEINVAEGDTIEADDPLVTVESDKATMEIPSPYSGKVGKILVSEG 185

Query: 66  DTVAVKAPLVRIETAGEAGEAAPDSIP--EALAEQVLDEPVAVSSRLEAKAPPQPEKPAP 123
           D ++    L+ +    E GEA  DS P  E  A++   EP +       + P Q  + AP
Sbjct: 186 DKLSEGHELLEMTVQEEGGEAEDDSEPASEEPAKEEKSEPKS------EEKPKQQAESAP 239

Query: 124 KPAPAPREAPDLSAKPLASPAVRLRARESGIDLRQVAGTGPAGRITHEDLDLFISRGAEP 183
           +P  A  E P   AK  A PAVR  ARE G DL ++ G+GP  RI  +D+  ++    + 
Sbjct: 240 EPQGATYEPPTPGAKVHAGPAVRKLARELGADLARIKGSGPKSRIIKDDVHAYVKSQLKQ 299

Query: 184 LPAQTGLVRKTAVEEVRMIG------LRRRIAEKMSLSTSR--------IPHITYVEEVD 229
               +G+   + +  V++        ++R    +M  +T+         +PH+T  E+ D
Sbjct: 300 AQQGSGVATGSGIPGVKLPDFSQFGEVKREAMSRMMFATANNMQRSWLNVPHVTQFEDAD 359

Query: 230 MTALEDLRATMNRDRKPEQAKLTILPFLMRALVKTVAEQPGVNATFDDHAGVIHRHAAVH 289
           +T +ED R       + +  K+T LPFL++A    +AE P  N + D     + R   +H
Sbjct: 360 ITDMEDFRKAQKAAGEKKGVKMTPLPFLLKACATALAELPQFNVSLDMERKEVVRKKYIH 419

Query: 290 IGIATQTPAGLTVPVVRHAEARGIWDCAAELNRLADAARTGTATRDELTGSTITISSLGA 349
           IGIA  TP GL VPV++  + +G+W+ AAE   LA  AR       E+ G+  TI+SLG 
Sbjct: 420 IGIAVDTPNGLMVPVIKDVDKKGLWELAAESAELAQKARDKQLKPAEMQGACFTITSLGG 479

Query: 350 IGGIASTPVINHPEVAIVGVNKIAVRPVWDGAQFVPRKIMNLSSSFDHRVIDGWDAAVFV 409
           IGG A TP++N PEVAI+GV+K A++PVWDG +F PR ++ LS S+DHR ++G DAA F 
Sbjct: 480 IGGTAFTPIVNTPEVAILGVSKAAMKPVWDGKEFQPRLMLPLSLSYDHRAVNGADAARFT 539

Query: 410 QRLKTLL 416
             L  LL
Sbjct: 540 TVLSQLL 546



 Score = 63.5 bits (153), Expect = 2e-14
 Identities = 46/128 (35%), Positives = 66/128 (51%), Gaps = 12/128 (9%)

Query: 1   MGEFIIKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWL 60
           M E  IK+PD+G G  E E++E  V  GD V  +  +  V +DKA+VE+PSP  GK+  +
Sbjct: 1   MSEQEIKVPDLG-GADEVEVIEITVSAGDSVEAEDPILTVESDKASVELPSPGAGKITKI 59

Query: 61  GAEVGDTVAVKAPLVRIETAGEAGEAAPDS--IPEALAEQVLDEPVAVSSRLEAKAPPQP 118
             +VGD V  +  +V +  A   G  + DS   PE  AE+         S  + +   + 
Sbjct: 60  TVKVGDKVK-EGDVVGMMEASADGGGSDDSEEEPEGKAEE--------KSEADKQEKSEE 110

Query: 119 EKPAPKPA 126
            KPAPK A
Sbjct: 111 SKPAPKKA 118


Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 544
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 426
Length of database: 554
Length adjustment: 34
Effective length of query: 392
Effective length of database: 520
Effective search space:   203840
Effective search space used:   203840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory