Align 3-oxo-acyl CoA thiolase (EC 2.3.1.16) (characterized)
to candidate GFF49 HP15_49 acetyl-CoA acetyltransferase
Query= metacyc::G185E-7833-MONOMER (386 letters) >lcl|FitnessBrowser__Marino:GFF49 HP15_49 acetyl-CoA acetyltransferase Length = 391 Score = 346 bits (888), Expect = e-100 Identities = 192/402 (47%), Positives = 258/402 (64%), Gaps = 28/402 (6%) Query: 1 MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG 60 M + ++DAVRT VG+ G+LAG+ LGAL LL R + ++DDV+ GCV IG Sbjct: 1 MKDVVIVDAVRTPVGRFRGSLAGVRADHLGALVLNELLYRNGLAAESIDDVVFGCVTQIG 60 Query: 61 GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS 120 Q+ NIAR S L AG+P VPG+T+DR+CGS + A+ AI +G+A+++VAGG +NMS Sbjct: 61 EQSANIARTSLLGAGWPTSVPGLTIDRKCGSGEAAVHCAFGAIAAGSAEIVVAGGAENMS 120 Query: 121 QIPISSAMTV-GEQFGFTSPTNESKQWLHRYGD--QEISQFRGSELIAEKWNLSREEMER 177 ++P+ S + GE FG H D + SQ +E +AEKWNL RE+++ Sbjct: 121 RVPMGSNRDLHGEAFG------------HLVSDRYEMTSQGEAAERVAEKWNLDREQLDA 168 Query: 178 YSLTSHERAFAAIRAGHFENEIITV----------ETESGPFRVDEG-PRESSLEKMAGL 226 ++L SH RA A +G+F++EI+ V E G F DE R++SLEK+A L Sbjct: 169 FALESHRRAAVAADSGYFKSEIVPVPVADYRENGAEKVEGKFAADETIRRDTSLEKLATL 228 Query: 227 QPLV--EGGRLTAAMASQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLT 284 + E GR+TA +SQISDG SA+LL S ++ GL+P+ARI ++ ADP MLT Sbjct: 229 KTSFRKENGRITAGNSSQISDGCSALLLMSSDVARNLGLKPKARIRAVTTVGADPTLMLT 288 Query: 285 GPIPATRYALDKTGLAIDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPL 344 GPI ATR L K GL +D+ID EINEAFA V +AW+KE+ ADP ++N NGGAIALGHPL Sbjct: 289 GPIGATRKVLAKAGLELDEIDLFEINEAFASVPLAWMKEVGADPERLNVNGGAIALGHPL 348 Query: 345 GATGAKLFTTMLGELERIGGRYGLQTMCEGGGTANVTIIERL 386 GA+GA++ T+ML ELER GRY LQ +C GG TIIER+ Sbjct: 349 GASGARIMTSMLNELERRRGRYALQAICCAGGMGTATIIERI 390 Lambda K H 0.317 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 391 Length adjustment: 30 Effective length of query: 356 Effective length of database: 361 Effective search space: 128516 Effective search space used: 128516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate GFF49 HP15_49 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.5582.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-143 462.4 1.2 6.4e-143 462.3 1.2 1.0 1 lcl|FitnessBrowser__Marino:GFF49 HP15_49 acetyl-CoA acetyltransfe Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF49 HP15_49 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 462.3 1.2 6.4e-143 6.4e-143 1 385 [] 6 388 .. 6 388 .. 0.96 Alignments for each domain: == domain 1 score: 462.3 bits; conditional E-value: 6.4e-143 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaalaaglpesvpa 76 ivdavRtp+g+++gsl+ ++a++L+a v++ell r+gl +e id+v++G+v+q geq aniaR+ +l ag p+svp+ lcl|FitnessBrowser__Marino:GFF49 6 IVDAVRTPVGRFRGSLAGVRADHLGALVLNELLYRNGLAAESIDDVVFGCVTQIGEQsANIARTSLLGAGWPTSVPG 82 9**************************************************************************** PP TIGR01930 77 ltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdlvktklsmge 153 lt++r C+Sg +Av+ a +i+aG a++vvaGG+E+mSrvp++++++l+ + +g+ ++ ++ s+ge lcl|FitnessBrowser__Marino:GFF49 83 LTIDRKCGSGEAAVHCAFGAIAAGSAEIVVAGGAENMSRVPMGSNRDLH--GEAFGHLVSDR-------YEMTSQGE 150 *********************************************9854..44455555554.......56789*** PP TIGR01930 154 tAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk........kkvvskDegirpnttlekLak 222 Ae++a+k+++ Re++D++al+Sh++aa A ++g+fk+eivpv v + + ++ De+ir++t+lekLa+ lcl|FitnessBrowser__Marino:GFF49 151 AAERVAEKWNLDREQLDAFALESHRRAAVAADSGYFKSEIVPVPVADYrengaekvEGKFAADETIRRDTSLEKLAT 227 *******************************************99887899*99988889***************** PP TIGR01930 223 LkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkagl 299 Lk+ f++++g+ +tAgNssq++DG +alllms++va++lgl+p+ari++++++g dp+ m++gp+ A++k+L+kagl lcl|FitnessBrowser__Marino:GFF49 228 LKTSFRKENGR-ITAGNSSQISDGCSALLLMSSDVARNLGLKPKARIRAVTTVGADPTLMLTGPIGATRKVLAKAGL 303 **********6.***************************************************************** PP TIGR01930 300 sisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvgg 376 ++++idl+EinEAFA++ la++ke+g d+e++NvnGGAiAlGHPlGasGari++++l+eL++r+++y+l+++C +g lcl|FitnessBrowser__Marino:GFF49 304 ELDEIDLFEINEAFASVPLAWMKEVG-ADPERLNVNGGAIALGHPLGASGARIMTSMLNELERRRGRYALQAICCAG 379 **************************.88************************************************ PP TIGR01930 377 GqGaAvile 385 G+G+A+i+e lcl|FitnessBrowser__Marino:GFF49 380 GMGTATIIE 388 *******97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory