Align 3-oxo-acyl CoA thiolase (EC 2.3.1.16) (characterized)
to candidate GFF49 HP15_49 acetyl-CoA acetyltransferase
Query= metacyc::G185E-7833-MONOMER (386 letters) >FitnessBrowser__Marino:GFF49 Length = 391 Score = 346 bits (888), Expect = e-100 Identities = 192/402 (47%), Positives = 258/402 (64%), Gaps = 28/402 (6%) Query: 1 MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG 60 M + ++DAVRT VG+ G+LAG+ LGAL LL R + ++DDV+ GCV IG Sbjct: 1 MKDVVIVDAVRTPVGRFRGSLAGVRADHLGALVLNELLYRNGLAAESIDDVVFGCVTQIG 60 Query: 61 GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS 120 Q+ NIAR S L AG+P VPG+T+DR+CGS + A+ AI +G+A+++VAGG +NMS Sbjct: 61 EQSANIARTSLLGAGWPTSVPGLTIDRKCGSGEAAVHCAFGAIAAGSAEIVVAGGAENMS 120 Query: 121 QIPISSAMTV-GEQFGFTSPTNESKQWLHRYGD--QEISQFRGSELIAEKWNLSREEMER 177 ++P+ S + GE FG H D + SQ +E +AEKWNL RE+++ Sbjct: 121 RVPMGSNRDLHGEAFG------------HLVSDRYEMTSQGEAAERVAEKWNLDREQLDA 168 Query: 178 YSLTSHERAFAAIRAGHFENEIITV----------ETESGPFRVDEG-PRESSLEKMAGL 226 ++L SH RA A +G+F++EI+ V E G F DE R++SLEK+A L Sbjct: 169 FALESHRRAAVAADSGYFKSEIVPVPVADYRENGAEKVEGKFAADETIRRDTSLEKLATL 228 Query: 227 QPLV--EGGRLTAAMASQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLT 284 + E GR+TA +SQISDG SA+LL S ++ GL+P+ARI ++ ADP MLT Sbjct: 229 KTSFRKENGRITAGNSSQISDGCSALLLMSSDVARNLGLKPKARIRAVTTVGADPTLMLT 288 Query: 285 GPIPATRYALDKTGLAIDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPL 344 GPI ATR L K GL +D+ID EINEAFA V +AW+KE+ ADP ++N NGGAIALGHPL Sbjct: 289 GPIGATRKVLAKAGLELDEIDLFEINEAFASVPLAWMKEVGADPERLNVNGGAIALGHPL 348 Query: 345 GATGAKLFTTMLGELERIGGRYGLQTMCEGGGTANVTIIERL 386 GA+GA++ T+ML ELER GRY LQ +C GG TIIER+ Sbjct: 349 GASGARIMTSMLNELERRRGRYALQAICCAGGMGTATIIERI 390 Lambda K H 0.317 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 391 Length adjustment: 30 Effective length of query: 356 Effective length of database: 361 Effective search space: 128516 Effective search space used: 128516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate GFF49 HP15_49 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.22087.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-143 462.4 1.2 6.4e-143 462.3 1.2 1.0 1 lcl|FitnessBrowser__Marino:GFF49 HP15_49 acetyl-CoA acetyltransfe Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF49 HP15_49 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 462.3 1.2 6.4e-143 6.4e-143 1 385 [] 6 388 .. 6 388 .. 0.96 Alignments for each domain: == domain 1 score: 462.3 bits; conditional E-value: 6.4e-143 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaalaaglpesvpa 76 ivdavRtp+g+++gsl+ ++a++L+a v++ell r+gl +e id+v++G+v+q geq aniaR+ +l ag p+svp+ lcl|FitnessBrowser__Marino:GFF49 6 IVDAVRTPVGRFRGSLAGVRADHLGALVLNELLYRNGLAAESIDDVVFGCVTQIGEQsANIARTSLLGAGWPTSVPG 82 9**************************************************************************** PP TIGR01930 77 ltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdlvktklsmge 153 lt++r C+Sg +Av+ a +i+aG a++vvaGG+E+mSrvp++++++l+ + +g+ ++ ++ s+ge lcl|FitnessBrowser__Marino:GFF49 83 LTIDRKCGSGEAAVHCAFGAIAAGSAEIVVAGGAENMSRVPMGSNRDLH--GEAFGHLVSDR-------YEMTSQGE 150 *********************************************9854..44455555554.......56789*** PP TIGR01930 154 tAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk........kkvvskDegirpnttlekLak 222 Ae++a+k+++ Re++D++al+Sh++aa A ++g+fk+eivpv v + + ++ De+ir++t+lekLa+ lcl|FitnessBrowser__Marino:GFF49 151 AAERVAEKWNLDREQLDAFALESHRRAAVAADSGYFKSEIVPVPVADYrengaekvEGKFAADETIRRDTSLEKLAT 227 *******************************************99887899*99988889***************** PP TIGR01930 223 LkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkagl 299 Lk+ f++++g+ +tAgNssq++DG +alllms++va++lgl+p+ari++++++g dp+ m++gp+ A++k+L+kagl lcl|FitnessBrowser__Marino:GFF49 228 LKTSFRKENGR-ITAGNSSQISDGCSALLLMSSDVARNLGLKPKARIRAVTTVGADPTLMLTGPIGATRKVLAKAGL 303 **********6.***************************************************************** PP TIGR01930 300 sisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvgg 376 ++++idl+EinEAFA++ la++ke+g d+e++NvnGGAiAlGHPlGasGari++++l+eL++r+++y+l+++C +g lcl|FitnessBrowser__Marino:GFF49 304 ELDEIDLFEINEAFASVPLAWMKEVG-ADPERLNVNGGAIALGHPLGASGARIMTSMLNELERRRGRYALQAICCAG 379 **************************.88************************************************ PP TIGR01930 377 GqGaAvile 385 G+G+A+i+e lcl|FitnessBrowser__Marino:GFF49 380 GMGTATIIE 388 *******97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.50 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory