Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate GFF3115 HP15_3058 leucine/isoleucine/valine transporter ATP-binding subunit
Query= TCDB::P0A9S7 (255 letters) >FitnessBrowser__Marino:GFF3115 Length = 251 Score = 354 bits (908), Expect = e-102 Identities = 169/251 (67%), Positives = 212/251 (84%) Query: 5 LLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILL 64 +L V L MRFGGLLAV+ V+L++ EIVS+IGPNGAGKTTVFNC++GFYKPTGG IL Sbjct: 1 MLEVQNLSMRFGGLLAVDEVSLDVQEHEIVSIIGPNGAGKTTVFNCMSGFYKPTGGKILF 60 Query: 65 RDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFR 124 + ++G P +I+R+G+VRTFQHVRLF +MTV+ENLLVAQH+ L T L SGL++TPS+R Sbjct: 61 EGKEVQGKPDYKISRLGMVRTFQHVRLFSQMTVVENLLVAQHRHLNTNLISGLIQTPSYR 120 Query: 125 RAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGL 184 + + ++LDRAA WL+R+GLL+ ANR+A NLAYG QRRLEIARCMVT+P++LMLDEPAAGL Sbjct: 121 KKEQKSLDRAAYWLDRVGLLDMANREAGNLAYGQQRRLEIARCMVTEPKLLMLDEPAAGL 180 Query: 185 NPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRNN 244 NP ETKEL++LI L+ +N +++LIEHDM LVM ISDRI V+NQG PLA+GTPE+IR N Sbjct: 181 NPAETKELNQLIISLKEDYNVSVVLIEHDMSLVMDISDRINVINQGRPLASGTPEEIRQN 240 Query: 245 PDVIRAYLGEA 255 DVI+AYLGEA Sbjct: 241 DDVIKAYLGEA 251 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory