Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate GFF3012 HP15_2956 sugar ABC transporter, permease protein
Query= uniprot:A8LLL4 (385 letters) >FitnessBrowser__Marino:GFF3012 Length = 289 Score = 123 bits (308), Expect = 7e-33 Identities = 71/216 (32%), Positives = 114/216 (52%), Gaps = 5/216 (2%) Query: 172 EGMARAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALI 231 EG++ F+N+ +T+PA +I L+ AF Y L+ +F G L +++ VP Q+ L+ Sbjct: 76 EGISGYFWNSFKMTVPAVLISTLLGAFNGYVLSKWKFKGSDLFFGMLLFGCFVPFQVVLL 135 Query: 232 PLLTLHNAIGIGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIF 291 P+ +G+ G L H +G+ RNY V +P +I+ A++DGA F IF Sbjct: 136 PMAATLGKLGLANTTSGLVLVHVIYGVAFTTLFFRNYYVAIPDALIKAARLDGAGFFTIF 195 Query: 292 TKIVLPLSFPALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMTNQIVELLGTRGG--N 349 +I+LP+S P I+QF WND L VF A+G + +T + L+ T G Sbjct: 196 FRILLPMSTPIFMVSLIWQFTQIWNDFLFGVVF---ASGDSQPITVALNNLVNTSTGVKE 252 Query: 350 WEILATAAFVSIAVPLLVFFSMQRFLVRGLLAGSVK 385 + + AA ++ L+V+ ++ +RGL AGSVK Sbjct: 253 YNVDMAAAMIAALPTLVVYIVAGKYFIRGLTAGSVK 288 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 289 Length adjustment: 28 Effective length of query: 357 Effective length of database: 261 Effective search space: 93177 Effective search space used: 93177 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory