Align L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 (characterized)
to candidate GFF612 HP15_595 dihydroxy-acid dehydratase
Query= SwissProt::B5ZZ34 (579 letters) >FitnessBrowser__Marino:GFF612 Length = 597 Score = 240 bits (612), Expect = 1e-67 Identities = 183/586 (31%), Positives = 283/586 (48%), Gaps = 70/586 (11%) Query: 43 GRPVIGILNTWSDMTPCNGHLRELAEKVKAGVWEAGGFPLEVPVFSASEN-TFRPTAMMY 101 G+P+I + N+++ P + HL++L + V + AGG E + + M+Y Sbjct: 19 GKPIIAVANSFTQFVPGHVHLKDLGQLVCREIESAGGVAKEFNTIAVDDGIAMGHDGMLY 78 Query: 102 ----RNLAALAVEEAIRGQPMDGCVLLVGCDKTTPSLLMGAASCDLPSIVVTGGPMLNGY 157 R + A +VE + D V + CDK TP +LM A ++P+I V+GGPM Sbjct: 79 SLPSREIIADSVEYMVNAHCADALVCISNCDKITPGMLMAAMRLNIPTIFVSGGPME--- 135 Query: 158 FRGERVGSGTHLWKFSEMVKAGE--MTQAEFLEAEASMSRSSGTCNTMGTASTMASMAEA 215 G+ S L MV A + + + E E + + G+C+ M TA++M + EA Sbjct: 136 -AGKTKLSEHKLDLVDAMVIAADPNASDEQVEEYERNACPTCGSCSGMFTANSMNCLTEA 194 Query: 216 LGMALSGNAAIPGVDSRRKVMAQLTGRRIVQMVK-----DDLK--PSEIMTKQAFENAIR 268 +G+AL GN ++ + R+ + GR+IV+ + DD P I + AFENA+ Sbjct: 195 IGLALPGNGSLLATHADREQLFLKAGRQIVENARRYYEEDDASVLPLSIASMAAFENAMV 254 Query: 269 TNAAIGGSTNAVIHLLAIAGRVGIDLSLDDWDRCGRDVPTIVNLMP-SGKYLMEEFFYAG 327 + A+GGSTN ++HLLA A G+ +L++ D+ R VP + + P S KY ME+ AG Sbjct: 255 MDIAMGGSTNTILHLLAAAQEGGVPFTLNEIDQLSRRVPQLCKVAPNSPKYHMEDVHRAG 314 Query: 328 GLPVVLKRLGEAGLLHKDALTVSGETV------WDEVK----DVVNW------------- 364 G+ +L L GL++ D TV +T+ WD ++ +VV + Sbjct: 315 GIMGILGELERGGLINTDLPTVHSKTMREALETWDIMRSPPTEVVEFYKAGPAGIPTQTA 374 Query: 365 --------------NEDVILPAEKALTSSGGIVVLRGNLAPKGAVLKPSAASPHLLVHKG 410 I E A +S GG+ VL GN+A G V+K + + V +G Sbjct: 375 FSQSTRWPTLDGDRETGCIRSVENAYSSEGGLAVLYGNIALDGCVVKTAGVDESIFVFEG 434 Query: 411 RAVVFEDIDDYKAKINDDNLDIDENCIMVMKNCGPKGYPGMAEVGNMGLPPKVLK-KGI- 468 +A VFE D A I D + E +++++ GP+G PGM E M P LK KG+ Sbjct: 435 KARVFESQDSAVAGILSDEVKPGE--VVIIRYEGPRGGPGMQE---MLYPTSYLKSKGLG 489 Query: 469 LDMVRISDARMSGTAYGTVVLHTSPEAAVGGPLAVVKNGDMIELDVPNRRLHLDISDEEL 528 D ++D R SG G + H SPEAA GG + +++NGD I +D+PNR +++++ EL Sbjct: 490 KDCALLTDGRFSGGTSGLSIGHASPEAAAGGAIGLIENGDTIRIDIPNRSINVELDQHEL 549 Query: 529 ARR-----LAEWQPN--HDLPTSGYAFLHQQHVEGADTGADLDFLK 567 RR W+P D S + AD GA D K Sbjct: 550 DRRREARDAKGWKPELPRDRKVSAALKAYALLATSADKGAVRDLEK 595 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 911 Number of extensions: 58 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 579 Length of database: 597 Length adjustment: 37 Effective length of query: 542 Effective length of database: 560 Effective search space: 303520 Effective search space used: 303520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory