Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate GFF2442 HP15_2386 UDP-glucose 4-epimerase
Query= curated2:Q56623 (328 letters) >FitnessBrowser__Marino:GFF2442 Length = 318 Score = 167 bits (423), Expect = 3e-46 Identities = 105/319 (32%), Positives = 158/319 (49%), Gaps = 3/319 (0%) Query: 8 MPKSILLTGSTGFVGTNLVKSLTLKSDYIVKSAVRHAVNKDDGLLFEVGDINASTDFELP 67 M +L+TG+TGFVG L L +V + GL + D+ +L Sbjct: 1 MENRVLVTGATGFVGRELCARLVSAGKDVVAVGRGGNLTGPSGLTYRQLDLETDDLQQLF 60 Query: 68 LKNTTVVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSIKVN 127 VVH A +AH E + L +R N T+ LA+ AI +GV+RF+F+SSI V+ Sbjct: 61 SGGIDAVVHLAGQAHGKGGSERQELDGFRRANVNVTLRLAEAAIQAGVRRFVFVSSIGVH 120 Query: 128 GEGTLVGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKD-SSMEVVIIRPTIVYGPGVKA 186 G T G +P Y SK EAE +L L + S E+ I+RP +VYG Sbjct: 121 GTAT-KGRSISENTPFSPGSPYTQSKMEAEVELTRLFEGVGSSELAIVRPPLVYGAKAPG 179 Query: 187 NFASLMRLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQVFLVSDGHDVS 246 NF SL+RL + PLPFG + N+RSL+S+ L D ++ CI +A NQ F+V+D VS Sbjct: 180 NFGSLLRLANSPAPLPFG-MCSNRRSLISVGTLADFLIACIQSTEAGNQAFVVADSSAVS 238 Query: 247 TAEMVRELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLGWK 306 TA++V L +++ +PVP +L GK ++ +L L++D + GW Sbjct: 239 TADIVSSLRRGMNRSERLIPVPSALVAAALRLIGKREMYTQLFCDLEIDNEKARRLDGWA 298 Query: 307 PPQTLQEGFKQTAQAFLQA 325 P + + + F ++ Sbjct: 299 PCDNTRSELETVGKLFYES 317 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 318 Length adjustment: 28 Effective length of query: 300 Effective length of database: 290 Effective search space: 87000 Effective search space used: 87000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory