GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pgmA in Marinobacter adhaerens HP15

Align phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) (characterized)
to candidate GFF210 HP15_209 phosphomannomutase

Query= BRENDA::Q8PGN7
         (450 letters)



>lcl|FitnessBrowser__Marino:GFF210 HP15_209 phosphomannomutase
          Length = 452

 Score =  539 bits (1388), Expect = e-158
 Identities = 262/448 (58%), Positives = 333/448 (74%), Gaps = 13/448 (2%)

Query: 3   MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAG 62
           M L  FKAYD+RGRVPD+LN  LA +IG A         V++G+D+RL+SP + EALS+G
Sbjct: 1   MDLSCFKAYDLRGRVPDQLNPVLAEKIGRAYVEITGAKKVIVGYDIRLSSPDIAEALSSG 60

Query: 63  LRASGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDT 122
           L A+G DV DIGLCGTE+VYF T + K  GG+MVTASHNP D+NGMK+V  ++RPISSD 
Sbjct: 61  LMAAGADVFDIGLCGTEQVYFATSHYKMDGGIMVTASHNPKDHNGMKMVGPESRPISSDN 120

Query: 123 GLFAIRDTVAADTAAPGEP--TASEQSRTDK----TAYLEHLLSYVDRSTLKPLKLVVNA 176
           GL  IRD V        EP   A +Q R +     +AY++HLL Y+D  +L PL +V NA
Sbjct: 121 GLNEIRDRVL-------EPFGDAPQQGRYEPLEVMSAYVDHLLGYIDAGSLSPLTIVCNA 173

Query: 177 GNGGAGLIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDNGADFGI 236
           GNGGAGL++D L  HLPFEFV+V H+PDG+FPNG+PNP+LPENR ATA AV   GA  GI
Sbjct: 174 GNGGAGLVIDELEQHLPFEFVKVHHQPDGHFPNGVPNPILPENRAATADAVIAEGAAMGI 233

Query: 237 AWDGDFDRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGG 296
           AWDGD+DRCFFFD  GRFIEGYY+VGLLA   L K  GGKV+HDPRLTWNT++ V+ AGG
Sbjct: 234 AWDGDYDRCFFFDENGRFIEGYYIVGLLADQFLRKTGGGKVIHDPRLTWNTMDLVKAAGG 293

Query: 297 IPVLCKSGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSL 356
             +  K+GHAFIK++MR E+AVYGGEMSAHHYFR+FAY DSGMIPWLL+AE + QSG++L
Sbjct: 294 EAIESKTGHAFIKQRMRDEDAVYGGEMSAHHYFRDFAYCDSGMIPWLLVAERLCQSGQTL 353

Query: 357 ADLVEARMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTDGISADFGQWRFNLR 416
           + L++AR++ +P SGEIN  + D    +A +   Y+  +  + + DG+S +F  WRFNLR
Sbjct: 354 SSLIDARIEAYPASGEINRTIDDPPKVIAAIEAKYSVGAKSVSHVDGVSIEFDDWRFNLR 413

Query: 417 SSNTEPLLRLNVETRGDAALLETRTQEI 444
            SNTEP++RLNVE+R D  L+E +T+E+
Sbjct: 414 MSNTEPVVRLNVESRADIPLMEEKTEEL 441


Lambda     K      H
   0.319    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 654
Number of extensions: 22
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 450
Length of database: 452
Length adjustment: 33
Effective length of query: 417
Effective length of database: 419
Effective search space:   174723
Effective search space used:   174723
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory