GapMind for catabolism of small carbon sources

 

Aligments for a candidate for tpi in Marinobacter adhaerens HP15

Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate GFF2201 HP15_2155 triosephosphate isomerase

Query= BRENDA::P0A858
         (255 letters)



>lcl|FitnessBrowser__Marino:GFF2201 HP15_2155 triosephosphate
           isomerase
          Length = 268

 Score =  209 bits (531), Expect = 6e-59
 Identities = 112/258 (43%), Positives = 161/258 (62%), Gaps = 6/258 (2%)

Query: 1   MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCA-VAIAPPEMYIDMAKREAEGSHI 59
           MR P+++GNWK+NGS      L+  +   L        + + PP  Y+   +     + I
Sbjct: 1   MRKPILIGNWKMNGSLQANQALMVRVLPRLRMFRKSVDLVVCPPHPYLFQVRDLLGYTGI 60

Query: 60  MLGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQ 119
           MLGAQN    +SGA+TGE SA ML+++G +Y ++GHSERR    E ++ +A ++  + + 
Sbjct: 61  MLGAQNASGFVSGAYTGEVSATMLQEMGCRYALVGHSERRLLFGEGNQEVAARYRSVLQS 120

Query: 120 GLTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSAT 179
           GLTPVLC+GET  + E+G+T  +  +Q+ AV+   G AA    ++AYEPVWAIGTGK+AT
Sbjct: 121 GLTPVLCVGETLEDRESGRTGLIIEQQLQAVIDEVGLAAMANGIVAYEPVWAIGTGKTAT 180

Query: 180 PAQAQAVHKFIRDHIAKVDA----NIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGA 235
           P Q   VH+ IR  +AK       +I+E++ + YGGSV  +NA ELF+  D+DG L+GGA
Sbjct: 181 PEQVSEVHQQIRQFLAKSAPESADDISEELRVIYGGSVKVANAYELFSLADVDGGLIGGA 240

Query: 236 SLKADAFAVIVKA-AEAA 252
           SL AD F  I  A AEA+
Sbjct: 241 SLHADEFGTIAGALAEAS 258


Lambda     K      H
   0.316    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 190
Number of extensions: 5
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 255
Length of database: 268
Length adjustment: 25
Effective length of query: 230
Effective length of database: 243
Effective search space:    55890
Effective search space used:    55890
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate GFF2201 HP15_2155 (triosephosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00419.hmm
# target sequence database:        /tmp/gapView.28237.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00419  [M=228]
Accession:   TIGR00419
Description: tim: triose-phosphate isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    1.9e-62  197.1   0.0    2.2e-62  196.8   0.0    1.0  1  lcl|FitnessBrowser__Marino:GFF2201  HP15_2155 triosephosphate isomer


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Marino:GFF2201  HP15_2155 triosephosphate isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  196.8   0.0   2.2e-62   2.2e-62       1     228 []       5     245 ..       5     245 .. 0.92

  Alignments for each domain:
  == domain 1  score: 196.8 bits;  conditional E-value: 2.2e-62
                           TIGR00419   1 lviinfKlnesvgkvelevaklaeev.aseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGaftGei 73 
                                         ++i+n+K+n+s++  + ++ ++   +   ++ v ++v pp+ +l  v+d +  + i+++Aqn     sGa+tGe+
  lcl|FitnessBrowser__Marino:GFF2201   5 ILIGNWKMNGSLQANQALMVRVLPRLrMFRKSVDLVVCPPHPYLFQVRDLLGyTGIMLGAQNASGFVSGAYTGEV 79 
                                         579********987776666666655156899*******************9999******************** PP

                           TIGR00419  74 sAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleere.......aartinnvatt 141
                                         sA ml+++G+++ l+gHsErR l+ e ++ ++++   + + gl++v+Cvgetle+re         +++++v ++
  lcl|FitnessBrowser__Marino:GFF2201  80 SATMLQEMGCRYALVGHSERRLLFGEGNQEVAARYRSVLQSGLTPVLCVGETLEDREsgrtgliIEQQLQAVIDE 154
                                         *********************************************************88888888889******* PP

                           TIGR00419 142 aaaaAlepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk....vskevaesvrvlyGasvtaaedaelaaq 212
                                          + aA+ + +vA+EPv++iGtGk++++ +  +v++++r++l+k     + +++e+ rv+yG+sv+ a+++el+  
  lcl|FitnessBrowser__Marino:GFF2201 155 VGLAAMANGIVAYEPVWAIGTGKTATPEQVSEVHQQIRQFLAKsapeSADDISEELRVIYGGSVKVANAYELFSL 229
                                         ******************************************9422234569999******************** PP

                           TIGR00419 213 ldvdGvLlasavlkae 228
                                          dvdG L+++a+l a+
  lcl|FitnessBrowser__Marino:GFF2201 230 ADVDGGLIGGASLHAD 245
                                         *************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (228 nodes)
Target sequences:                          1  (268 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 7.42
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory