GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Marinobacter adhaerens HP15

Align methylcrotonoyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.4) (characterized)
to candidate GFF2598 HP15_2542 methylcrotonoyl-coenzyme A carboxylase 1 (alpha)

Query= BRENDA::Q9I299
         (655 letters)



>lcl|FitnessBrowser__Marino:GFF2598 HP15_2542
           methylcrotonoyl-coenzyme A carboxylase 1 (alpha)
          Length = 656

 Score =  582 bits (1499), Expect = e-170
 Identities = 324/656 (49%), Positives = 433/656 (66%), Gaps = 18/656 (2%)

Query: 8   IQRLLVANRGEIACRVMRSARALGIGSVAVHSDIDRHARHVAEADIAVDLGGAKPADSYL 67
           +++LL+ANRGEIA RV+R+A+ALG  +VAV+S+ D  A HV  AD AV +G A+ + SYL
Sbjct: 2   LRKLLIANRGEIAVRVIRTAKALGYRTVAVYSEADAKAMHVELADEAVCIGPAQVSASYL 61

Query: 68  RGDRIIAAALASGAQAIHPGYGFLSENADFARACEEAGLLFLGPPAAAIDAMGSKSAAKA 127
             D I+ AA  +GA  IHPGYGFLSENA FA AC++AGL+F+GPPA+AI+ MGSK  +K 
Sbjct: 62  NSDAILEAARKTGADCIHPGYGFLSENAAFANACKDAGLVFVGPPASAIELMGSKRRSKI 121

Query: 128 LMEEAGVPLVPGYHGEAQDLETFRREAGRIGYPVLLKAAAGGGGKGMKVVEREAELAEAL 187
            M+EAGVP+VPGY G   + +     A  IGYP+++KA+AGGGG+GM++VE E+ELA+ +
Sbjct: 122 AMQEAGVPVVPGYEGNNANDDELIAAAKDIGYPLMIKASAGGGGRGMRLVESESELADNI 181

Query: 188 SSAQREAKAAFGDARMLVEKYLLKPRHVEIQVFADRHGHCLYLNERDCSIQRRHQKVVEE 247
             A+ E+K AFGD  +++EK +++PRHVEIQVFADRHG+ +YL ERDCS+QRRHQKVVEE
Sbjct: 182 KRARSESKQAFGDDELILEKAVIEPRHVEIQVFADRHGNAVYLGERDCSVQRRHQKVVEE 241

Query: 248 APAPGLGAELRRAMGEAAVRAAQAIGYVGAGTVEFLLDERGQFFFMEMNTRLQVEHPVTE 307
           AP+P +  ELR+AMGEAAV+AA A  Y GAGTVEFL+D+   F+F+EMNTRLQVEHPVTE
Sbjct: 242 APSPFVTPELRQAMGEAAVKAALACNYEGAGTVEFLVDKHRNFYFLEMNTRLQVEHPVTE 301

Query: 308 AITGLDLVAWQIRVARGEALPLTQEQVPLNGHAIEVRLYAEDPEGDFLPASGRLMLYREA 367
            ITG DLVAWQ+ VA G  LPL+Q+ + LNGHAIEVRLYAEDP   F P +G L  + E 
Sbjct: 302 LITGQDLVAWQLNVAEGRPLPLSQDDIHLNGHAIEVRLYAEDPAHGFTPQTGSLYAF-EP 360

Query: 368 AAGPGRRVDSGVREGDEVSPFYDPMLAKLIAWGETREEARQRLLAMLAETSVGGLRTNLA 427
           A G G R D+GVR GD ++P YDPMLAK+IAWG+ R+EAR+RL+  L +T+V G+ TN  
Sbjct: 361 AEGEGLRFDTGVRSGDAITPHYDPMLAKVIAWGQNRDEARRRLIRSLEDTTVFGVTTNRH 420

Query: 428 FLRRILGHPAFAAAELDTGFIAR-HQDDLLPAPQALPEHFWQAAAEAWLQSEPGHRRDDD 486
           FL RI+    F A    T F+ +  +DD    PQ L       AA        G      
Sbjct: 421 FLSRIIADETFGAGGATTAFLQQAFKDDPSLQPQNLTIRQLALAACVLDHGISG------ 474

Query: 487 PHSPWSRNDGWRSALARES-----DLMLRCRDERRCVRL---RHASPSQYRLDGDDLVSR 538
             S WS      + +  E+     +L++     R  V +   RH+   + + DG  L   
Sbjct: 475 -QSAWSNAPATMTPIKLETGDTTVELLVTRSGSRLSVSMGETRHSLVLESQRDG-HLCII 532

Query: 539 VDGVTRRSAALRRGRQLFLEWEGELLAIEAVDPIAEAEAAHAHQGGLSAPMNGSIVRVLV 598
            +GV +     R+G  L+L+  G+  ++  V       A  A  G + A M+G+I+ VLV
Sbjct: 533 DNGVRQACQYHRQGDSLYLQAFGQSWSVRDVTHQPARTAGGAGSGRIQATMDGAIIDVLV 592

Query: 599 EPGQTVEAGATLVVLEAMKMEHSIRAPHAGVVKALYCSEGELVEEGTPLVELDENQ 654
           E GQ+V  G TLV+LEAMKMEH ++A   G V  +  S+G+ V+    LV++  N+
Sbjct: 593 EAGQSVHQGDTLVILEAMKMEHPVKADRDGRVAEILASKGDQVKRSQLLVQITANE 648


Lambda     K      H
   0.319    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1072
Number of extensions: 39
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 655
Length of database: 656
Length adjustment: 38
Effective length of query: 617
Effective length of database: 618
Effective search space:   381306
Effective search space used:   381306
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory