Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate GFF12 HP15_12 enoyl-CoA hydratase/isomerase
Query= BRENDA::F4JML5 (301 letters) >FitnessBrowser__Marino:GFF12 Length = 270 Score = 166 bits (421), Expect = 4e-46 Identities = 100/251 (39%), Positives = 143/251 (56%), Gaps = 3/251 (1%) Query: 52 DSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLKE 111 D + V L+RP NAIN E+ + A E +D RV++IR CAGAD+KE Sbjct: 20 DGNVGWVILNRPKQINAINDEIRVGVPEALEQFEKDKEIRVIVIRGEGERGLCAGADIKE 79 Query: 112 RRTMSPS-EVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGENAV 170 RR S +V + R++ S I+ + P I AI G +GGGLE+ALACD+R NAV Sbjct: 80 RRGPENSLQVRKRMECARWIES-IDQTTKPVIVAIHGYCMGGGLELALACDIRYASPNAV 138 Query: 171 FGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLV-NICVTAGEA 229 LPETGL +IPG GGTQRLSR+V + +++ +G ++DA A + GLV + T Sbjct: 139 MALPETGLGLIPGGGGTQRLSRVVAPGHALDMLLSGDRLDAARARSIGLVTRVAETQESL 198 Query: 230 HEKAIEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAA 289 ++ E+AQ+I K PLA K+A +E + GL++E + L T+D E +A Sbjct: 199 LQEVSELAQKIAMKPPLATTYVKRAARASLELELKRGLDLELDLFALLAPTEDAREAASA 258 Query: 290 FAEKRKPLYTG 300 F+E+R P + G Sbjct: 259 FSERRSPNFIG 269 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 270 Length adjustment: 26 Effective length of query: 275 Effective length of database: 244 Effective search space: 67100 Effective search space used: 67100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory