Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate GFF947 HP15_926 branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__Marino:GFF947 Length = 267 Score = 169 bits (427), Expect = 7e-47 Identities = 96/255 (37%), Positives = 145/255 (56%), Gaps = 6/255 (2%) Query: 5 SNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAG 64 S + VL+ + K F G A+ DV + +++G ++ LIGPNGAGKTT FN++T P G Sbjct: 2 SEQYVLETRNLVKEFKGFVAVDDVNLKVQKGHIHALIGPNGAGKTTVFNLLTKFLIPTRG 61 Query: 65 TFELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRT 124 + +A+ GI R+FQ +F MTALEN+ V G+ F Sbjct: 62 QILFKDQDITTMKSAAIARQGIVRSFQISAVFPHMTALENIRVALQTFEGTSF---SFWK 118 Query: 125 KGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEP 184 G + + +R ELLD VG+ +FA+ L+YG +R LE+A LA +PQL+ LDEP Sbjct: 119 SGNSLHK--LNQRCMELLDAVGLAEFANTTTVELAYGRKRALELATTLAMEPQLLLLDEP 176 Query: 185 AAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEV 244 GM + + ++ EL+ R + RT+L++EH++ +V LCDR+TVL G + EG+ A V Sbjct: 177 TQGMGSEDVDRVVELV-RKAAEGRTVLMVEHNLSVVSKLCDRITVLAQGAVLTEGDYATV 235 Query: 245 QKNEKVIEAYLGTGG 259 + +V E Y+G+ G Sbjct: 236 SGDPRVREVYMGSDG 250 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 267 Length adjustment: 25 Effective length of query: 235 Effective length of database: 242 Effective search space: 56870 Effective search space used: 56870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory