Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate GFF950 HP15_929 branched-chain amino acid ABC transporter, permease protein
Query= TCDB::Q8DQI0 (292 letters) >FitnessBrowser__Marino:GFF950 Length = 315 Score = 160 bits (404), Expect = 4e-44 Identities = 94/281 (33%), Positives = 158/281 (56%), Gaps = 3/281 (1%) Query: 7 QLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFLINSFQMNFFVALI 66 QL+ G+I G+ YALL+LG +++G++K+INFAHG +YM+GA + + +N++VAL+ Sbjct: 35 QLLIGIINGAFYALLSLGLAVIFGLLKIINFAHGAMYMLGAMTTVLMFDYLGVNYWVALL 94 Query: 67 VAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLEYGMVYLVGANTRAFPQA-I 125 +A L GV IE+ R + I L+ GV+ ++ +V G + + + Sbjct: 95 LAPLLVGAFGVAIEYFLLRRIAGQDHIYSLLLTFGVALIISGVLVNWFGVSGLRYTMPDM 154 Query: 126 QTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAVSVDSDAAQLMGINV 185 +LG + + + ++ +L++ +++KTK+G +RA + DS Q GINV Sbjct: 155 FKGGVNLGFMFMPYYRAWVIVAALVVCFATWFVIEKTKLGAYLRAGTEDSQLMQGFGINV 214 Query: 186 NRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAVLGGIGIIPGAALGG 245 IS T+ G ALA AGVL A Y S+ P+MG + F V+GG+G I GA + G Sbjct: 215 PLLISLTYGFGVALAAFAGVLAAPIY-SVTPVMGSATLITVFAVVVIGGMGSIGGAIITG 273 Query: 246 FVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGILGK 286 ++G++E F AI++ +++L+L+ RP+G+ GK Sbjct: 274 ILMGVIEGLTKTF-YPPASSAIIFLVMVLVLMFRPSGLFGK 313 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 315 Length adjustment: 27 Effective length of query: 265 Effective length of database: 288 Effective search space: 76320 Effective search space used: 76320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory