Align Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized)
to candidate GFF3112 HP15_3055 high-affinity leucine-specific leucine-specific-binding periplasmic protein of high-affinity branched-chain amino acid ABC transporter transport system periplasmic binding protein
Query= SwissProt::P21175 (373 letters) >FitnessBrowser__Marino:GFF3112 Length = 370 Score = 474 bits (1221), Expect = e-138 Identities = 222/347 (63%), Positives = 289/347 (83%), Gaps = 1/347 (0%) Query: 26 AADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNGAQLEGVIYDDACDPKQA 85 AA I+I +AGP+TGPVAQYGDMQ +GA MAIEQIN GGV G +L V YDD CDPKQA Sbjct: 24 AAAEIQIGIAGPMTGPVAQYGDMQFSGARMAIEQINANGGVMGEELVAVEYDDVCDPKQA 83 Query: 86 VAVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEGVLMITPSATAPEITSRGYKLIFRTI 145 V VAN +VNDGV+FV+GH+CSSSTQPA+DIYEDEG+LM+TP++T+PEIT RGY+L+FRTI Sbjct: 84 VTVANSLVNDGVRFVIGHLCSSSTQPASDIYEDEGILMVTPASTSPEITERGYELVFRTI 143 Query: 146 GLDNMQGPVAGKFIAERYKDKTIAVLHDKQQYGEGIATEVKKTVEDAGIKVAVFEGLNAG 205 GLD+MQGPVA ++IA + ++ +A++HDKQQYGEGIAT V+ T++DAG+++A+FEG+ AG Sbjct: 144 GLDSMQGPVAARYIASQNPER-VAIVHDKQQYGEGIATAVRDTLKDAGVEIAMFEGITAG 202 Query: 206 DKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITAIAG 265 DKDF++L++KLK+A V +VY+GGYHPE+GL+LRQA A LDARFMGPEGVGN +I IAG Sbjct: 203 DKDFSSLVTKLKQADVDYVYYGGYHPELGLILRQANSADLDARFMGPEGVGNKDINTIAG 262 Query: 266 DASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAGEAD 325 +A+EG+L TLP AF+Q +N+AL+ AF+ K +DPSG FVL +Y+AV ++A+GIE AG D Sbjct: 263 EAAEGLLVTLPPAFDQKAENQALVKAFEDKGEDPSGPFVLTSYTAVQLVAEGIEAAGSTD 322 Query: 326 PEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYEWHKDATRTEV 372 P VA ALR TF+TP G + +D+ GD+K+F+F VYEWH D ++T V Sbjct: 323 PFDVAAALREGTFQTPIGTVEYDKAGDMKSFEFVVYEWHSDGSKTPV 369 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 370 Length adjustment: 30 Effective length of query: 343 Effective length of database: 340 Effective search space: 116620 Effective search space used: 116620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory