Align Amino acid ABC transporter, membrane protein (characterized, see rationale)
to candidate GFF3089 HP15_3032 amino acid ABC transporter, inner membrane subunit
Query= uniprot:Q88GX2 (236 letters) >FitnessBrowser__Marino:GFF3089 Length = 247 Score = 117 bits (292), Expect = 3e-31 Identities = 74/222 (33%), Positives = 120/222 (54%), Gaps = 7/222 (3%) Query: 16 LERYGPRFIDGLLVTAKLVAISFSLGAVLGLLLALARLSRSLVLQRMAAGYVYFFRGSPL 75 L+ YGP +DG +VT +L +S +L LGL+ A A+LS+S V + +A Y RG P Sbjct: 17 LKGYGPALMDGAIVTIELAFLSLALSVALGLIGASAKLSQSRVAKGIATTYTTLIRGVPD 76 Query: 76 LAQLFLLYYG----LGSLKGF-WQDVGLWWFFR-DAWFCTLLAFTLNTAAYQAEIFRGSL 129 L + L YYG + L + W+ + +FF+ D + ++ L AY E FRG+ Sbjct: 77 LVMMLLFYYGGQVAVNMLSDYIWEAYEIDFFFQFDPFISGVVTIGLIFGAYMTETFRGAF 136 Query: 130 MAVAPGQHEAARALNLKRSTTFFKVILPQSLLVAIGPLGNELILMIKASAIASLVTIYDL 189 +AV GQ EAARA R TF +++LPQ + A+ LGN +++K +A+ S++ + D+ Sbjct: 137 LAVETGQIEAARAYGFTRFHTFRRIMLPQMMRHALPGLGNNWQVLLKTTALVSIIGLTDM 196 Query: 190 MGVT-KLAFSRSFDFQIYLWAAVLYLVIVELVRRLLKHLEAR 230 + V + A + F ++ A +YL + +K L+ R Sbjct: 197 VRVAEEAAKAERMPFHFFIPVAFVYLALTAGSELFIKWLDKR 238 Lambda K H 0.331 0.144 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 247 Length adjustment: 23 Effective length of query: 213 Effective length of database: 224 Effective search space: 47712 Effective search space used: 47712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory