Align ABC transporter for D-Glucose-6-Phosphate, permease component 2 (characterized)
to candidate GFF3013 HP15_2957 sugar ABC transporter, permease protein
Query= reanno::WCS417:GFF4323 (302 letters) >FitnessBrowser__Marino:GFF3013 Length = 308 Score = 449 bits (1156), Expect = e-131 Identities = 211/289 (73%), Positives = 250/289 (86%) Query: 14 DALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTNSTFLPTYKWAGLAQYARLFDNDR 73 DALQRWLPKLV+AP+ ++ VG YGY+LWT VLSFT+S+FLP Y + G QYA+L NDR Sbjct: 20 DALQRWLPKLVVAPTFVLIGVGIYGYMLWTGVLSFTSSSFLPVYDFVGFDQYAKLMANDR 79 Query: 74 WWVASKNLAVFGGMFIGITLVIGVTLAIFLDQKIRREGFIRTIYLYPMALSMIVTGTAWK 133 W AS NL +FGG+F+ LVIGV LAIFLDQ+IR+EG IRTIYLYPMALSMIVTGT WK Sbjct: 80 WLTASINLGIFGGLFVLSCLVIGVILAIFLDQRIRQEGAIRTIYLYPMALSMIVTGTVWK 139 Query: 134 WLLNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVD 193 W+LNP +GL+KL+ DWGW F DWL+ D +Y +V+AAVWQASGF+MA+FLAGLRGVD Sbjct: 140 WILNPSLGLEKLMHDWGWTSFSFDWLVSSDMAIYTIVMAAVWQASGFVMALFLAGLRGVD 199 Query: 194 QSIVRAAQIDGASMPRIYWSVVLPSLRPVFFSAVMILAHIAIKSFDLVAAMTAGGPGYSS 253 SI+RAA++DGAS+P IYW ++LPSLRPVFFSAVM+LAHIAIKSFDLV AMTAGGPGYS+ Sbjct: 200 SSIIRAARVDGASLPLIYWKIILPSLRPVFFSAVMVLAHIAIKSFDLVMAMTAGGPGYST 259 Query: 254 DLPAMFMYSFTFSRGQMGMGSASAILMLGAILAIIVPYLYSELRTKRND 302 DLPA+FMY+ TF+RGQMG+GSASA+LMLGAILA+IVPYLYSELR KR+D Sbjct: 260 DLPAVFMYAHTFTRGQMGLGSASAMLMLGAILALIVPYLYSELREKRHD 308 Lambda K H 0.330 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 308 Length adjustment: 27 Effective length of query: 275 Effective length of database: 281 Effective search space: 77275 Effective search space used: 77275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory