Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate GFF2987 HP15_2931 glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Marino:GFF2987 Length = 320 Score = 155 bits (391), Expect = 2e-42 Identities = 105/284 (36%), Positives = 149/284 (52%), Gaps = 9/284 (3%) Query: 28 DATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIV 87 D T D + ++ D + + V +T + LK ++ ++ G + D A GI Sbjct: 40 DRTTPDQILERIRGFDTVLVNKVVLTREHFDACPELKTIAVVATGLNNIDQAAAKDHGIK 99 Query: 88 LANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFG---VDVQGKTL 144 + N + + A +L+LA A R+++ V+AGHW S L ++++G+TL Sbjct: 100 VMNVTNYGRSTVAQHTMALMLALATRLLDYTRDVQAGHWGKSDMFCLMDHPIMELEGRTL 159 Query: 145 GIVGLGRIGGAVARRAALGFNMKVLYTNRSAN-PQAEEAYGARRVELAELLATADFVCLQ 203 GIVG G +G VA RAA F MKVL R P + Y R+ L ELL AD V L Sbjct: 160 GIVGYGDLGQGVAERAA-AFGMKVLLGARPGQEPGVVDGYS--RIPLDELLPQADVVSLH 216 Query: 204 VPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEP 263 LT ET+ LIGA ELK MK ++LIN SRG V+E+AL +AL+ G I GAG DV EP Sbjct: 217 CLLTDETRDLIGARELKMMKPDSLLINTSRGGLVNEQALADALRAGEIGGAGFDVLTEEP 276 Query: 264 LPSDSPLL--KLANVVALPHIGSATHETRHAMARNAAENLVAAL 305 + +PLL + N++ PH A+ E R + A NL + L Sbjct: 277 PRNGNPLLADDIPNLIVTPHSAWASREARQRIVGITAVNLKSVL 320 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 320 Length adjustment: 28 Effective length of query: 293 Effective length of database: 292 Effective search space: 85556 Effective search space used: 85556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory