Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate GFF4127 HP15_4067 spermidine/putrescine ABC transporter ATPase subunit
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__Marino:GFF4127 Length = 362 Score = 201 bits (510), Expect = 3e-56 Identities = 114/280 (40%), Positives = 159/280 (56%), Gaps = 1/280 (0%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIA 80 V +L++ G F ++GPSGCGK+T LR+LAG + G I I + + V P R + Sbjct: 20 VDHVSLDVPAGTFFSILGPSGCGKTTLLRLLAGFDKPDQGDIHIRGERMNDVPPNRRPVN 79 Query: 81 MVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQ 140 MVFQ+ AL+P MTVG+N+ + LK E KR+ +GL + R P+ LSGGQ Sbjct: 80 MVFQHLALFPTMTVGDNIAYGLKRRKMPLVERRKRIARVLEQVGLPDLEHRNPQELSGGQ 139 Query: 141 RQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEAL 200 RQRVA+ R +V P + L+DEPL LD KLR Q + ++ LQ++ G T VY+THDQ+EA+ Sbjct: 140 RQRVALARCLVLEPTLLLLDEPLGALDLKLREQMKVELKHLQKQFGTTFVYITHDQSEAM 199 Query: 201 TMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTF-SVKDGDATSGHAR 259 M D++AV++DG QV P ELY PA FVAGF+G G SV+D A Sbjct: 200 VMSDQVAVMRDGRFDQVAPPEELYREPATPFVAGFVGDNNRLSGELVSVRDSLAELRLDD 259 Query: 260 IKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTDLS 299 L +A+ + R + RPE+L + + S S Sbjct: 260 GVLVQGRVASDNLQAGHRAELYIRPESLVLSGDALSPGFS 299 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 362 Length adjustment: 30 Effective length of query: 346 Effective length of database: 332 Effective search space: 114872 Effective search space used: 114872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory