Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate GFF4122 HP15_4062 spermidine/putrescine ABC transporter, ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >FitnessBrowser__Marino:GFF4122 Length = 373 Score = 250 bits (639), Expect = 4e-71 Identities = 136/293 (46%), Positives = 190/293 (64%), Gaps = 17/293 (5%) Query: 6 LVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDK 65 L ++ K FG T + + LE+ DGEF+ LLGPSGCGKTT LR++AG E P G I + Sbjct: 8 LSNLSKQFGGKTVLDGLDLEIYDGEFITLLGPSGCGKTTLLRLMAGFEHPDEGTITLAG- 66 Query: 66 LVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAE 125 E P++R + VFQ YAL+PHM+V+DN+A+ LK+ K P+ EI QRV E Sbjct: 67 -----ENLTHTAPENRPLNTVFQHYALFPHMSVFDNVAYGLKMEKRPKDEIRQRVDEALA 121 Query: 126 LLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKL 185 ++ L + RKP +LSGGQ+QRVA+ RA+V++P++ L+DEPLS LD KLR M+ ELK+L Sbjct: 122 MVQLQDFARRKPHQLSGGQQQRVAIARAVVKRPRLLLLDEPLSALDYKLRRTMQVELKRL 181 Query: 186 QRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFIGSPPM 245 QR+LG+T ++VTHDQ EA++M DR+ V+ G++QQ+G+P EVY++PAN F A F+G Sbjct: 182 QRELGITFVFVTHDQEEALSMSDRVVVLKDGLVQQLGTPREVYERPANLFTARFVGE--T 239 Query: 246 NFLDAIV--TEDGFVDFGEFRLK--LLPDQFEVLGELGYVGREVIFGIRPEDL 294 NF V +DG + F LK L F V E + + +RPED+ Sbjct: 240 NFFPGTVESVQDGSIKVDVFGLKRTLRRPDFPVQAE-----QSLHVLLRPEDI 287 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 373 Length adjustment: 30 Effective length of query: 342 Effective length of database: 343 Effective search space: 117306 Effective search space used: 117306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory