Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate GFF205 HP15_204 oligopeptide/dipeptide ABC transporter, ATPase subunit
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__Marino:GFF205 Length = 336 Score = 297 bits (760), Expect = 3e-85 Identities = 144/306 (47%), Positives = 213/306 (69%), Gaps = 3/306 (0%) Query: 23 FPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDIT 82 F + + + A++G+ +E+++GE L +VGESGCGKST+ RT++ LL P G+I ++G+ I Sbjct: 32 FRRKQEAVHAINGVDLEVQKGEALCVVGESGCGKSTVARTVMGLLSPSAGEIHYDGQRID 91 Query: 83 NLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIG-TKKERRKRVEELLD 141 NL K+ PYR+KMQ+IFQ+P SLNP+MT+ + +E+P+ H + + R ++ E++ Sbjct: 92 NLERKDSLPYRRKMQMIFQNPYASLNPRMTIQQTLEEPIRFHHPDWSPVQVRDKIHEVMH 151 Query: 142 MVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEE 201 VGI +++ N F HEFSGGQ+QRI IARALA++P+FIV DEP+SALDVSIQAQ+++LL + Sbjct: 152 SVGIDQDWGNRFGHEFSGGQRQRIAIARALAVDPEFIVADEPISALDVSIQAQVLNLLMD 211 Query: 202 IQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVP 261 Q+ G++YLFI H+LAVVEH +VAVMYLG++ E D +F P HPYT+ALL ++P Sbjct: 212 AQESRGLTYLFITHDLAVVEHFGTRVAVMYLGRVCELADTKTLFSAPRHPYTQALLSAIP 271 Query: 262 KIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNHFVSCH 321 K+ + + LKGE+P+P++LP GC F RC C ++ P+L + V+CH Sbjct: 272 KL--EDDRPNHIRLKGEVPTPVNLPSGCVFHGRCPYANERCRQELPQLITTDGGTQVACH 329 Query: 322 LVRSYR 327 V R Sbjct: 330 AVEEGR 335 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 336 Length adjustment: 28 Effective length of query: 300 Effective length of database: 308 Effective search space: 92400 Effective search space used: 92400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory