Align Glucose-binding protein aka TT_C0328, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate GFF3014 HP15_2958 extracellular solute-binding protein family 1
Query= TCDB::Q72KX2 (414 letters) >FitnessBrowser__Marino:GFF3014 Length = 416 Score = 180 bits (457), Expect = 6e-50 Identities = 126/407 (30%), Positives = 189/407 (46%), Gaps = 19/407 (4%) Query: 7 AIGMVLGLSALAQGGKLEIFSWW-AGDEGPALEALIRLYKQKYPGVEVINATVTGGAGVN 65 A+ L + Q G++E+ WW AG E A AL + + + G + V GG G Sbjct: 14 AVSAALLPAQALQAGEVEVLHWWTAGGEARAAVALKEMMEDQ--GHTWKDFAVAGGGGEA 71 Query: 66 ARAVLKTRMLGGDPPDTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLQAFPKGLIDLI 125 A VLKTR + G+PP Q+ G++ I W + L + W Q P + D++ Sbjct: 72 AMTVLKTRAVSGNPPAAAQIK-GLD-IREWAKLGFLTSLDDVAEANNWGQLIPPVIADVM 129 Query: 126 SYKGGIWSVPVNIHRSNVMWYLPAKLKEWGVNPPRTWDEFLATCQTLKQKGLEAPLALGE 185 Y+ +VPVN+HR N +W P L + GV P+T DEF + LK G+ G+ Sbjct: 130 QYEDSYVAVPVNVHRVNWLWANPETLNKVGVGVPKTLDEFYQAAEKLKAAGITPLAHGGQ 189 Query: 186 NWTQQHLWESVALAVLGPDDWNNLW--NGKLKFTDPKAVRAWEVFGRVLDCANKDAAGLS 243 W ++E+VALAV+GPDD+ + + + + + F +V+ + +AAG Sbjct: 190 PWQDATVFEAVALAVMGPDDFASAFVEHDMDVINSAQMEEVFAEFAKVMSYVDDNAAGRD 249 Query: 244 WQQAVDRVVQGKAAFNVMGDWAAGYMTTTLKLKPGTDFAWAPSPGTQGVFMMLSDSFGL- 302 W A V++G+AA +MGDWA G T L PG D+ A +PGT G F DSF + Sbjct: 250 WNTATGMVIRGEAAMQIMGDWAKGEFTAA-GLTPGEDYVCAAAPGTGGQFTFNVDSFAMF 308 Query: 303 -PKGAKNRQNAINWLRLVGSKEGQDTFNPLKGSIAARLDSDPSKYNAYGQSAMRDWRSNR 361 N + + R + E Q FN KGSI R D ++ Q++M ++S+ Sbjct: 309 SLSDEDNTKAQKDLARTIMEPEFQAVFNKAKGSIPVRTD-----FDTCAQASMDTFKSSA 363 Query: 362 ----IVGSLVHGAVAPESFMSQFGTVMEIFLQTRNPQAAANAAQAIA 404 +V S HG Q V+ F+ + N A Q A Sbjct: 364 EDGGLVPSFAHGLATTSYVQGQIFDVVTNFVNSDNKDPARATDQLAA 410 Lambda K H 0.319 0.134 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 416 Length adjustment: 31 Effective length of query: 383 Effective length of database: 385 Effective search space: 147455 Effective search space used: 147455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory