Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate GFF3684 HP15_3626 betaine aldehyde dehydrogenase
Query= BRENDA::P42412 (487 letters) >FitnessBrowser__Marino:GFF3684 Length = 489 Score = 258 bits (659), Expect = 3e-73 Identities = 168/484 (34%), Positives = 254/484 (52%), Gaps = 16/484 (3%) Query: 2 AEIRKLKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWS 61 A + ++N+++G ++ + T + VVNPAT +V+ +V ++ + A ++A F WS Sbjct: 3 ASLPVVQNFVHGRFLANSTGETFPVVNPATGQVIYEVEVADESVQQAAIESARAGFAEWS 62 Query: 62 KVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALG-EVGRGIENVEFAAGAPS 120 + R+RIL +L + +ELA + GK +EA +V G + VEF AG Sbjct: 63 AMTAIERSRILLRAVAILRERNDELAAAEVRDTGKPWQEAEAVDVVTGADAVEFFAG--- 119 Query: 121 LMMGDSLASIATDVEAANY---RYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKP 177 + S+ D+ Y R P+G+ GI +N+P+ + CW A+A GN I KP Sbjct: 120 --LAPSIEGNQQDLGGDFYYTRREPLGICAGIGAWNYPIQIACWKSAPALACGNAMIFKP 177 Query: 178 SERTPLLTEKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYVY 237 SE TP+ KL E+F +AG+P GVFNVV GA +V + HPEI +SF G G+ V Sbjct: 178 SEETPMGAVKLAEIFTEAGVPAGVFNVVQGAAEVGQWLTHHPEIAKVSFTGEVATGKKVM 237 Query: 238 KKGSENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIA 297 S LK V G K+ I+ +DA+LE+ ++ + F + GE C V V E + Sbjct: 238 AAASSTLKDVTMELGGKSPLIIFDDADLENAISAAMVGNFYTQGEICTNGTRVFVHEDLY 297 Query: 298 DEFMAKLQEKVA-DIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGREN 356 F+ +L E+ +IK G+ ++ G +I ++ L YI KGL EGA L GR Sbjct: 298 PRFIERLLERTRNNIKPGDPMNPDTNFGALISAKHRDLVLDYIAKGLSEGATLSHGGRAF 357 Query: 357 VSDD---GYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGAC 413 +D GYFV PTIF + T +MTI K+EIF PV+SV+ ++ E I AN ++ A Sbjct: 358 EPEDSKGGYFVEPTIFTDCTDDMTIVKEEIFGPVMSVLTFRDEDEVIARANNTDTGLAAG 417 Query: 414 LFTSNSNAIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTR 473 +FT++ I AG+ IN +P A P G+K S G NG++++ YT+ Sbjct: 418 VFTNDIRRAHRVIHQIQAGICWINSYGASP-AEMPVGGYKLSGIG--RENGRETIAHYTQ 474 Query: 474 KKVV 477 K V Sbjct: 475 IKSV 478 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 562 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 489 Length adjustment: 34 Effective length of query: 453 Effective length of database: 455 Effective search space: 206115 Effective search space used: 206115 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory