Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate GFF3986 HP15_3926 acyl-CoA synthetase
Query= BRENDA::A7KUK6 (562 letters) >FitnessBrowser__Marino:GFF3986 Length = 554 Score = 182 bits (461), Expect = 4e-50 Identities = 161/562 (28%), Positives = 263/562 (46%), Gaps = 55/562 (9%) Query: 12 IPEVDLWTFLFERKDRAYPDDK-IIYQDADTQRHYTYKSLRDASLDFGKGLKALYEWRKG 70 +P+ ++T L E R YPD II+ DA TY+ L + ++ G +KG Sbjct: 19 LPKTSVYTNL-EISARRYPDHTAIIFYDAPI----TYRRLNE-EVETLAGYLQEQGVKKG 72 Query: 71 DVLALFTPNSIDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAK----GLVTQAS 126 D + L+ NS + + L A + P NP EL + ++ A G Sbjct: 73 DRVLLYMQNSPQYVISYYAILRADAVVIPVNPMNRSAELEHFIADTGATVCLAGQELAGF 132 Query: 127 VLPVAREAAKKVGMPEDRIILIGDQRDPDARVKHFTSV--RNISGATRYR---------- 174 + P+ ++ + I + D D + V R++ G + Sbjct: 133 IAPMIGDSNLDQVVVASYSTYIDPETDLDLPAEVAAPVWSRDLPGVVTWEVAMAAGYAPG 192 Query: 175 KQKITPAKDVAFLVYSSGTTGVPKGVMISHRNIVANIRQQFIAEGEMLSWN-GGPDGKGD 233 TP D+A + YSSGTTG PKG M +HR+++A + WN PD Sbjct: 193 PHTATP-DDLAVIPYSSGTTGAPKGCMHTHRSVMATAIHRIF-------WNLTTPDSVQ- 243 Query: 234 RVLAFLPFYHIYGLTCLITQALYKGYHLIVMSKFDIEKWCAHVQNYRCS-FSYIVPPVVL 292 LA LPF+H+ G+T + + G ++M+++D ++ Y+ + ++ IV V Sbjct: 244 --LATLPFFHVTGMTGSMNGPIAAGAASVIMTRWDRTTASRLIERYKVTGWTNIVTMAVD 301 Query: 293 LLGKHPVVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSETSPTTH-SQR 351 L +P + +YDLSSL M+ G A + + E + + +GYGLSET TH + Sbjct: 302 FLS-NPDIGQYDLSSLNMIGGGGATMPSAVAEKLKRMTGLDYIEGYGLSETMAATHINPN 360 Query: 352 WEDWREAMGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGYHENPEA 411 + +G +P + D E K G GE GE+ GP V GY P Sbjct: 361 AHPKSQCLG-----IPVFDVDSRIIDVDTLEEK--GPGETGEIVSCGPQVTRGYWNRPSE 413 Query: 412 TKGCLSE-DG--WFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDNDAI 468 T+ E DG +F+TGD+GY D G F++ DRVK +I G++V P+E+EG + + AI Sbjct: 414 TEAAFVEIDGKQFFRTGDLGYYDEDGYFFMVDRVKRMINASGYKVWPSEVEGMMYRHPAI 473 Query: 469 DDVAVIGIESETHGSEVPMACVVRSAKSKSSGTSEKDEAARIIKWLDSKVASHKRLRGGV 528 +V +I G E AC+V + +++ + A II W ++A++K + + Sbjct: 474 HEVCIISAPDPKRG-ETVKACIVLTPEAEG-----QTSAGDIIAWCKEQMATYK-VPTMI 526 Query: 529 HFVDEIPKNPSGKILRRILKQK 550 FVD++PK+P+GK++ R L+++ Sbjct: 527 DFVDQLPKSPTGKLMWRALQEE 548 Lambda K H 0.317 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 814 Number of extensions: 40 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 562 Length of database: 554 Length adjustment: 36 Effective length of query: 526 Effective length of database: 518 Effective search space: 272468 Effective search space used: 272468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory