Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate GFF61 HP15_61 chain A, alpha-keto acid dehydrogenase-like protein
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__Marino:GFF61 Length = 409 Score = 190 bits (482), Expect = 7e-53 Identities = 116/291 (39%), Positives = 158/291 (54%), Gaps = 16/291 (5%) Query: 28 AAAAPAAAGVPPDRQLLMYRAMVVGRAFNRQATAFSRQGRLAVYPSSRGQEACQVGSALA 87 AA P G+ PD R+M++ R F+ + RQG+ + Y S G+EA +LA Sbjct: 63 AAIGPWDPGLSPDVLRKGLRSMLLTRVFDERLFRVHRQGKTSFYMKSTGEEAIGAAQSLA 122 Query: 88 VRPTDWLFPTYRESVALLTRGIDPVQVLTLFRGDQHCGYDPVTEHTAPQCTP-------- 139 + D FPTYR L+ R + ++ ++ DP+ P Sbjct: 123 LSQGDMCFPTYRVMSWLMARDYPLIDMVNQIFSNEK---DPLKGRQLPILFSARDYGFYS 179 Query: 140 ----LATQCLHAAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLV 195 + ++ HA G A A+ GD +AL YIG+G T+EGDFHEAL +A+V RAPV+ V Sbjct: 180 LSGNVGSRFGHAVGWAMASAYKGDDKIALGYIGEGTTAEGDFHEALTFASVYRAPVILCV 239 Query: 196 QNNQYAISVPLAKQTA-ARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGP 254 NNQ+AIS A A T A KA YG+PG+R+DGND L V+ A AAERAR G Sbjct: 240 TNNQWAISSYSGIAGAEATTFAAKALAYGLPGLRVDGNDFLAVWSATKWAAERARNNLGA 299 Query: 255 TLIEAVTYRIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLAAGVLD 305 TLIE TYR H+ +DD T+YRPA EA+ W DP++RL+ L++ G D Sbjct: 300 TLIEFFTYRAAGHSTSDDPTKYRPADEAEHWPLGDPLERLKHHLISLGEWD 350 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 409 Length adjustment: 30 Effective length of query: 338 Effective length of database: 379 Effective search space: 128102 Effective search space used: 128102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory