Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate GFF63 HP15_63 2-oxoisovalerate dehydrogenase, E1 component, beta subunit
Query= uniprot:G1UHX5 (328 letters) >FitnessBrowser__Marino:GFF63 Length = 268 Score = 204 bits (520), Expect = 2e-57 Identities = 115/266 (43%), Positives = 153/266 (57%), Gaps = 21/266 (7%) Query: 70 MAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYGGGIGGVEHH 129 M YG RPV E+QF + PA++QLVS A+LR R+ G P+T+R PYGGGI G + H Sbjct: 1 MGAYGLRPVAEIQFADYILPAYDQLVSEAARLRYRSGGEFWAPITVRSPYGGGIFGGQTH 60 Query: 130 SDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLY------------ 177 S S E + GL V P+ DA LL SI S DP++FLEPKR+Y Sbjct: 61 SQSPEAIFAHITGLKTVIPSNPYDAKGLLISSIESDDPIIFLEPKRIYNGPFDGHHERQI 120 Query: 178 --WRKEA-LGLPVD--TGPLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEV 232 W +P T PLG A RHG+ T++AYG V A E E G D E+ Sbjct: 121 KSWADHPDASVPEGHYTVPLGKAATVRHGSDVTVLAYGAMVHVAKAGIE---ESGVDAEL 177 Query: 233 IDLRTLMPLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVT 292 +DLR+++PLD + SV++TGR V++HEA + G G E++A + ERCFYHL++P+ RV Sbjct: 178 LDLRSIVPLDIDAIVQSVKKTGRCVILHEASRYGGFGGELSALVQERCFYHLKSPIERVA 237 Query: 293 GFDVPYPPPLLERHYLPGVDRILDAV 318 G+D PY P E Y PG R+ A+ Sbjct: 238 GWDTPY-PHAFEWDYFPGPMRLAKAL 262 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 268 Length adjustment: 26 Effective length of query: 302 Effective length of database: 242 Effective search space: 73084 Effective search space used: 73084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory