Align dihydromonapterin reductase (EC 1.5.1.50) (characterized)
to candidate GFF67 HP15_67 short-chain dehydrogenase/reductase SDR
Query= BRENDA::P0AFS3 (240 letters) >FitnessBrowser__Marino:GFF67 Length = 133 Score = 142 bits (359), Expect = 2e-39 Identities = 70/135 (51%), Positives = 96/135 (71%), Gaps = 2/135 (1%) Query: 105 MMQIHVNTPYLLNHALERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTR 164 M IH+ PY++N+A + L +G A DI+H TDY + GS KH+AYA++KA L+NMT Sbjct: 1 MFMIHMQAPYMINNACDVLFYDNGPA--DIVHVTDYGAQHGSGKHVAYASTKAGLENMTL 58 Query: 165 SFARKLAPEVKVNSIAPSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSC 224 S+A+KLAP VKVNSIAP LI+FN+ D EY++++LNKS++ PG + V V YL+ + Sbjct: 59 SYAKKLAPRVKVNSIAPFLIMFNKWDSEEYKEKSLNKSVLGIEPGPEVVYQGVRYLMDNI 118 Query: 225 FVTGRSFPLDGGRHL 239 +VTG LDGGRHL Sbjct: 119 YVTGECLNLDGGRHL 133 Lambda K H 0.322 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 133 Length adjustment: 19 Effective length of query: 221 Effective length of database: 114 Effective search space: 25194 Effective search space used: 25194 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory