Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate GFF964 HP15_943 aldehyde dehydrogenase family protein
Query= BRENDA::P05091 (517 letters) >FitnessBrowser__Marino:GFF964 Length = 505 Score = 392 bits (1006), Expect = e-113 Identities = 208/470 (44%), Positives = 296/470 (62%), Gaps = 4/470 (0%) Query: 40 FINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDAS 99 ++N + A + + F +V+P G + +A D+ D D+AV AARAAF+ G W ++ + Sbjct: 30 YLNGTYQWAANGEAFTSVSPIDGRELASIASCDQSDADQAVMAARAAFEAGI-WSQLAPA 88 Query: 100 HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK 159 R +L R A+LIE LA LETLD GKP + VD+ + +R+ A DK +G+ Sbjct: 89 KRKAVLLRFAELIEAHGDELALLETLDMGKPINHASNVDVPATARAIRWTAEAIDKVYGE 148 Query: 160 TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL 219 P + EP+GV I+PWNFP++M AWK+ PALATGN V++K +E++PL+A+ Sbjct: 149 LAPTPHNQIGMISREPMGVVAAIVPWNFPMIMAAWKIAPALATGNSVILKPSEKSPLSAI 208 Query: 220 YVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL 279 +A L EAG P GV N++PG+G T G A+A H DVD + FTGST + + + + AG SN+ Sbjct: 209 RLAALAGEAGVPAGVFNVLPGYGHTVGKALALHMDVDCLVFTGSTNVAKQLMIYAGQSNM 268 Query: 280 KRVTLELGGKSPNIIMSDA-DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVER 338 KRV LE GGKSPNI+ +DA D+ A +A A+ FNQG+ C AGSR V+ I EFV Sbjct: 269 KRVWLEAGGKSPNIVFADAPDLKKAAAEAASAIAFNQGEVCTAGSRLLVENSIRAEFVRL 328 Query: 339 SVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADR--GY 396 K+ G+P D T G VD+ Q +I+ YI G+ EGA+L+ GG + G Sbjct: 329 ICEALKTWRPGHPLDPATTCGAIVDQAQLDRIIDYIGIGQSEGARLVEGGQRILENTGGL 388 Query: 397 FIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKA 456 F+QPTVF V + M IA EEIFGPV+ ++ F T +E V AN+S YGLAAAV+T +++ A Sbjct: 389 FVQPTVFDGVNNQMRIASEEIFGPVLSVIGFDTADEAVAIANDSIYGLAAAVWTSNINTA 448 Query: 457 NYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVK 506 + +++AL+AG+VW+N YD +PFGG+K SG+GR+ + YTE+K Sbjct: 449 HKVAKALRAGSVWINHYDGGDMTAPFGGFKQSGNGRDKSVHAFDKYTELK 498 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 627 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 505 Length adjustment: 35 Effective length of query: 482 Effective length of database: 470 Effective search space: 226540 Effective search space used: 226540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory