Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate GFF4155 HP15_4095 branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:D8J1T6 (255 letters) >FitnessBrowser__Marino:GFF4155 Length = 271 Score = 214 bits (545), Expect = 1e-60 Identities = 112/252 (44%), Positives = 164/252 (65%), Gaps = 3/252 (1%) Query: 4 TLLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFE 63 ++L+I ++S FGG++AL V + + +IGPNGAGKT+ FN I+G Y+P GT Sbjct: 2 SILEISNLSLSFGGVKALQDVSFRVPENTVTTIIGPNGAGKTSLFNCISGFYKPQQGTIR 61 Query: 64 LDGKPYSPSA-PHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKA 122 G+ S P + A G+ARTFQNI LF MTVL+N+ +G HV K + A+ Sbjct: 62 YQGQTLPGSIKPPKRAALGLARTFQNIALFRGMTVLDNIKLGAHVHMKSGLLSALAYFGP 121 Query: 123 AREEEAAIREK-SQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPA 181 AR EE A+R+ ++++DF+ I ++ LSYG Q+R+E+ARALA P++L LDEP Sbjct: 122 ARREEMAVRKDVEERIIDFLEIDHIRRQPVASLSYGLQKRVELARALAMQPKVLMLDEPV 181 Query: 182 AGMNATEKLGLRELLVKIQAE-GKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADV 240 AGMN EK + ++ I+ E G T+L++EHD+ ++M + + I VL++G+ I EG+PADV Sbjct: 182 AGMNREEKEDMARFILDIREEWGVTVLMVEHDMGMVMDISDHIAVLNFGQVITEGLPADV 241 Query: 241 QKNPAVIEAYLG 252 Q NP VI+AYLG Sbjct: 242 QNNPEVIKAYLG 253 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 271 Length adjustment: 25 Effective length of query: 230 Effective length of database: 246 Effective search space: 56580 Effective search space used: 56580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory