Align Glycine betaine/proline betaine transporter BetS (characterized)
to candidate GFF2851 HP15_2795 transporter, BCCT family protein
Query= SwissProt::G3XCN6 (706 letters) >FitnessBrowser__Marino:GFF2851 Length = 531 Score = 425 bits (1092), Expect = e-123 Identities = 222/495 (44%), Positives = 311/495 (62%), Gaps = 10/495 (2%) Query: 51 FKVNLPVFVGSVAVIALFVGIGVIAPKRAESIFSGMQTAILSGFGWLYLLSVAVFLFSML 110 F ++ VF + +I FV +I P A+ + + ++ F W +LLS +F+ L Sbjct: 25 FDIHNIVFPLTAILIVAFVVGTLIFPAGAKELLDSAKNGAIAVFDWGFLLSANLFVVFCL 84 Query: 111 FLAFSRYGELKLGPDDSEPEFRYLSWIAMLFAAGMGIGLMYFAVGEPMTHFA----SPPE 166 L F G++++G D++PEF LSW AMLFAAGMG GLM+++V EP+ ++ +P Sbjct: 85 ALIFMPVGKIRIGGLDAKPEFSLLSWFAMLFAAGMGTGLMFWSVAEPVAYYTDWYGTPLG 144 Query: 167 AEPLTIAAQREAMSVTFFHWGVHAWAIYSVVGLSLAYFGYRYNLPLTVRSGLYPLLKEGI 226 EP T R AM T +HWG+H WAIY++VGLSL++F + LPLT+RS +P+L + + Sbjct: 145 VEPNTAEGARLAMGATMYHWGLHPWAIYAIVGLSLSFFAFNKGLPLTIRSAFFPILGDKV 204 Query: 227 HGPIGHVVDIFAICGTMFGLATSLGFGILQINSGLNYLLGIPQSIYVQLLLVTVVTAIAT 286 G G+V+D ++ T+FGLATSLGFG Q SG++YL I + +Q+ ++ VTA+AT Sbjct: 205 WGWPGNVIDTVSVLATIFGLATSLGFGAQQAASGISYLFDIEGGLNIQVGVIAGVTAVAT 264 Query: 287 ISVVTGVEKGVRILSETNLFLAVLLMLFVLVVGPTGTLMRDFVQNIGLYLDSLVLRTFNI 346 +SV+ G+ GVRILS N+ +A LL+LFV+ GPT + + Y ++ + Sbjct: 265 LSVIRGIHGGVRILSNANMIMAGLLLLFVIFAGPTLAVFQWLWDTSVSYASNMFSLSNPF 324 Query: 347 YAYEPRPWIDSWTLFYWAWWISWSPFVGMFIARISRGRTVREFVTAVLFVPAMFTFLWMT 406 E W WT+FYWAWWISWSPFVGMFIAR+S GRTVREFVTAVL +P + T WM+ Sbjct: 325 GREEDTTWFHGWTVFYWAWWISWSPFVGMFIARVSHGRTVREFVTAVLIIPTIITLFWMS 384 Query: 407 VFGNTAI-YVDTTIANGELARDVKADLSVALFQFFEYLPWPAVTSTLAVLLVSIFFVTSS 465 FG A+ V I G L + ++S+A+FQ E + +TS + + LV FFVTSS Sbjct: 385 AFGGGALNQVQNEI--GVLGSEGLTEVSLAMFQMLENISLSGITSFIGITLVLTFFVTSS 442 Query: 466 DSGSLVIDTIASGGETATPALQRIFWCSLSGIVAAVLLSTGG---LTALQSATISTALPF 522 DSGSLVID+I SGG+T P QRIFW G +A VLL GG L ALQ+ +S LPF Sbjct: 443 DSGSLVIDSITSGGKTDAPKAQRIFWAVTEGTIAGVLLFVGGEQALNALQAGALSVGLPF 502 Query: 523 SLVMLILVWSLFVGM 537 +LV+L++ +SLF G+ Sbjct: 503 TLVLLVMTYSLFKGL 517 Lambda K H 0.326 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1055 Number of extensions: 77 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 706 Length of database: 531 Length adjustment: 37 Effective length of query: 669 Effective length of database: 494 Effective search space: 330486 Effective search space used: 330486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory