Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate GFF3902 HP15_3842 iron(III) ABC transporter, ATP-binding protein
Query= SwissProt::P17328 (400 letters) >FitnessBrowser__Marino:GFF3902 Length = 371 Score = 173 bits (439), Expect = 6e-48 Identities = 94/260 (36%), Positives = 164/260 (63%), Gaps = 5/260 (1%) Query: 44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103 VKD +L +E GE+ ++G SG GK+T++R+ L PTRG+V + ++ ++ Sbjct: 38 VKDINLHLEAGEVVCLLGPSGCGKTTLLRIAAGLQMPTRGKVFLGSSLVSAPGGVQVPPE 97 Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPD 163 +R + + FQ AL PH+TVL+N FG ++ + +++R +AL+ L ++G+ + A+ YP Sbjct: 98 KRN-VGLAFQESALFPHLTVLENVCFG--ISSMPKKQQRTRALELLGRLGMADAANVYPH 154 Query: 164 ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISH 223 LSGG +QRV LARALA +P ++L+DE FS+LD +R +++D+ + + + + ++H Sbjct: 155 TLSGGQQQRVALARALAPSPRVMLLDEPFSSLDARLRDQIRDDTLHVLKELNTATLLVTH 214 Query: 224 DLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRS 283 D +EAM + DRIA+M++GE+VQ GTP ++ NPA +V FF V+ + + + Sbjct: 215 DPEEAMFMADRIALMRDGEIVQTGTPTDLYCNPAEPFVVNFFGQVNEHRGVVHNGVV-TT 273 Query: 284 PVGLIRKTPGFGPRSALKLL 303 P+G + + GF S++++L Sbjct: 274 PLGHL-EAKGFEDGSSVRIL 292 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 371 Length adjustment: 30 Effective length of query: 370 Effective length of database: 341 Effective search space: 126170 Effective search space used: 126170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory