Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate GFF961 HP15_940 putrescine ABC transporter, periplasmic putrescine-binding protein
Query= SwissProt::Q02UB7 (367 letters) >FitnessBrowser__Marino:GFF961 Length = 368 Score = 396 bits (1017), Expect = e-115 Identities = 199/369 (53%), Positives = 257/369 (69%), Gaps = 3/369 (0%) Query: 1 MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVY 60 M+K LA ++A S+ + A +V VYNWSDYIA DTL KFT+ETGIKV+YDVY Sbjct: 1 MLKLCKPQALAASVALSLCASSAFAAEEV-RVYNWSDYIAEDTLAKFTEETGIKVIYDVY 59 Query: 61 DSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEV 120 DSNE+LEA LL+G+SGYD+VVPSN ++AKQI A + LD SKLPN NLN DLM LE Sbjct: 60 DSNEILEAALLSGRSGYDLVVPSNHYVAKQISANAFVALDHSKLPNMSNLNPDLMDDLEK 119 Query: 121 SDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQ--CGVSFL 178 DPG++ A+PY+WGT G GYN +++ GD+AP DSW LVF PE KL CG++ L Sbjct: 120 VDPGSQFALPYLWGTNGYGYNEGRIQEILGDSAPTDSWALVFDPEVTGKLATGGCGIAML 179 Query: 179 DSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVA 238 DS E++ AA+ Y+G P+++N ++K E+ IRP +TYFHSS+YI DLANG++CVA Sbjct: 180 DSGEEMVRAAMAYIGLDPNSNNADDIKKGGEVIKAIRPNITYFHSSRYIGDLANGDLCVA 239 Query: 239 IGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMK 298 GYSGDI QA +RAEEA+N ++Y IPKEGA +FDM+ IP A N E A +NFLM+ Sbjct: 240 AGYSGDILQAAARAEEAENGNVIRYTIPKEGAVLWFDMMTIPAGAPNVENAHKLMNFLMR 299 Query: 299 PEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTR 358 PEI+A++T+ V + N N A V I +D IYP++EVMKKLY P QR MTR Sbjct: 300 PEIIADVTNYVWYANPNKPANEFVDPEILSDTSIYPTDEVMKKLYIMEGRPQDAQRLMTR 359 Query: 359 SWTKIKSGK 367 +WT +KSG+ Sbjct: 360 TWTNVKSGR 368 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 368 Length adjustment: 30 Effective length of query: 337 Effective length of database: 338 Effective search space: 113906 Effective search space used: 113906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory