Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate GFF1423 HP15_1388 iron-containing alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >FitnessBrowser__Marino:GFF1423 Length = 395 Score = 195 bits (495), Expect = 2e-54 Identities = 126/359 (35%), Positives = 198/359 (55%), Gaps = 9/359 (2%) Query: 32 KALIVTDGQLVKLGLLDSLFSALDEHQMSYH-LFDEVFPNPTEELVQKGFAAYQSAECDY 90 + +IVTD + GLL+ + +A +E + ++D+V P+ + +V+ Y+ +CD Sbjct: 35 RPMIVTDKGVRAAGLLEPVIAACEESGLEITTIYDDVPPDSSTTVVRDIAGIYRQEKCDS 94 Query: 91 IIAFGGGSPIDTAKAVKILTANPGPSTA-YSGVGKVKNAGVPLVAINTTAGTAAEMTSNA 149 IIA GGGS IDT KAV IL + G A YSG G +K+ P + TTAGT +E+TS A Sbjct: 95 IIAVGGGSAIDTGKAVNILVSEGGDDIAKYSGAGVLKHPLKPFFVVPTTAGTGSEVTSVA 154 Query: 150 VIIDSARKVKEVIIDPNIIPDIAVDDASVMLEIPASVTAATGMDALTHAVEAYVSVGAHP 209 VI D A+ VK ++P+ A+ D + L +P +TAAT MDA+THA EA+ + +P Sbjct: 155 VITDEAKGVKLPFTSSFLLPNAAIIDPRMTLTLPPHITAATAMDAMTHATEAFTCMAKNP 214 Query: 210 LTDANALEAIRLINLWLPKAVDDGHNLEAREQMAFGQYLAGMAFNSAGLGLVHALAHQPG 269 L+DA A AI+ I+ L + +D+ + + R ++A +AG+AF+++ +GLVHAL H G Sbjct: 215 LSDAYATAAIKKISQSLLQVMDNPKDSDGRLELAQASTMAGIAFSNSMVGLVHALGHATG 274 Query: 270 ATHNLPHGVCNAILLPIVENFNRPNAVARFARIAQAM-GVETRGMSDEAASQEA-INAIR 327 A +LPHG+C ++ LP +N + + G E + + EA I+AIR Sbjct: 275 AVCHLPHGLCMSLYLPYALEYNLETIREPLGELLLYLEGPEVFAATPASRRAEASISAIR 334 Query: 328 ----TLSKRVGIPEGFSKLG-VTKEDIEGWLDKALADPCAPCNPRTASRDEVRGLYLEA 381 L KR +P + G VT+ ++ + AL D NP+ + ++ R + A Sbjct: 335 KLRDALYKRCQLPRTLKETGKVTEAQLDHIAEMALDDGSIMFNPKEVTLEDARSVLRRA 393 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 395 Length adjustment: 30 Effective length of query: 352 Effective length of database: 365 Effective search space: 128480 Effective search space used: 128480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory