Align Sorbitol dehydrogenase; SDH; Galactitol 2-dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; EC 1.1.1.-; EC 1.1.1.16; EC 1.1.1.14 (characterized)
to candidate GFF2263 HP15_2213 3-ketoacyl-(acyl-carrier-protein) reductase
Query= SwissProt::Q59787 (256 letters) >FitnessBrowser__Marino:GFF2263 Length = 247 Score = 131 bits (330), Expect = 1e-35 Identities = 84/258 (32%), Positives = 132/258 (51%), Gaps = 15/258 (5%) Query: 1 MRLDGKTALITGSARGIGRAFAEAYVREGARV---AIADINLEAARATAAEIGPAACAIA 57 M L+GKTAL+TG+ RGIG+A A A +GA V A ++ E+ G + Sbjct: 1 MSLEGKTALVTGATRGIGQAIARALAAQGAEVVGTATSEAGAESITNDLQSAGYKGYGMV 60 Query: 58 LDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFM 117 ++V D ASI+ + EL ++ G+ ILVNNA + ++ + + + + N+S Sbjct: 61 MNVADPASIEAGLKELTEKSGAPLILVNNAGITRDNLLMRLKDDDWASVLETNLSSVYRT 120 Query: 118 MQAVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINV 177 +AV R M A + G+IIN++S G A G YCA KA V T+S + GI Sbjct: 121 SKAVLRGM-AKAKWGRIINISSVVAGMGNAGQGNYCAAKAGVEGFTRSLAKEMSNRGITA 179 Query: 178 NAIAPGVVDGEHWDGVDAKFADYENLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATP 237 N +APG +D + +D K ++ + +P GR+G E++ + FLA+ Sbjct: 180 NCVAPGFIDTDMTKKLDDK-----------QRGAMLEIIPAGRLGEPEEVAAVVAFLASD 228 Query: 238 EADYIVAQTYNVDGGNWM 255 A Y+ +T NV+GG +M Sbjct: 229 AAGYVTGETINVNGGMYM 246 Lambda K H 0.321 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 247 Length adjustment: 24 Effective length of query: 232 Effective length of database: 223 Effective search space: 51736 Effective search space used: 51736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory