Align Sorbitol dehydrogenase; SDH; Galactitol 2-dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; EC 1.1.1.-; EC 1.1.1.16; EC 1.1.1.14 (characterized)
to candidate GFF4203 HP15_4143 3-oxoacyl-(acyl-carrier-protein) reductase
Query= SwissProt::Q59787 (256 letters) >FitnessBrowser__Marino:GFF4203 Length = 265 Score = 143 bits (361), Expect = 3e-39 Identities = 94/258 (36%), Positives = 133/258 (51%), Gaps = 11/258 (4%) Query: 3 LDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATA---AEIGPAACAIALD 59 L+GKT ++TG GIGRA + EG+ VA+ D + ARATA E G A A A D Sbjct: 14 LEGKTVIVTGGGGGIGRAVCLRFAEEGSLVAVLDRDESTARATADLITEAGGRAKAYAAD 73 Query: 60 VTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQ 119 +TD A I VA + G +LVNNA P ++ + +D+L A+N++G L M Sbjct: 74 ITDYAMITDTVAAIESDLGVPTVLVNNAGFDRFMPFLKTEPKLWDQLIAVNLTGALNMHH 133 Query: 120 AVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNA 179 V MIA G GGK+IN+AS A R G + VY A KA ++ +++ L + +N Sbjct: 134 VVLPGMIAAG-GGKVINVASDAARVGSSGESVYAACKAGLVGFSKTVARELATKNVCLNV 192 Query: 180 IAPGVVDGEHWDGVDAKFADYENLPRGEKKRQV-GAAVPFGRMGRAEDLTGMAIFLATPE 238 + PG D GV E P EK + AVP R+ + ED G+ LA+ + Sbjct: 193 VCPGPTDTALLKGV------AETAPNPEKLLEAFRNAVPMKRLAQPEDYPGLIALLASDD 246 Query: 239 ADYIVAQTYNVDGGNWMS 256 A++I Q +V GG M+ Sbjct: 247 ANFITGQVISVSGGLTMA 264 Lambda K H 0.321 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 265 Length adjustment: 24 Effective length of query: 232 Effective length of database: 241 Effective search space: 55912 Effective search space used: 55912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory