Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate GFF1028 HP15_1007 3-hydroxyacyl-CoA dehydrogenase type II
Query= reanno::Koxy:BWI76_RS22230 (259 letters) >FitnessBrowser__Marino:GFF1028 Length = 253 Score = 84.3 bits (207), Expect = 2e-21 Identities = 74/228 (32%), Positives = 106/228 (46%), Gaps = 29/228 (12%) Query: 2 NQVAVVIGGGQTLGEFLCRGLAAEGYRVAVVDIQSDKATRVAQSINAEYGEGTAWGFGAD 61 N A+V GG LGE R LAA G +VA++D+Q ++ +VA+ I + E D Sbjct: 5 NVAAIVTGGASGLGEGAARALAASGCKVAILDLQKEQGRKVAEDIGGIFLE-------CD 57 Query: 62 ATSEASVVALARGVDDIFSRVDLLVYSAGIAKAAFI----SDFALGDFDRSLQVNLVGYF 117 +S S A + + V AGIA A+ I L +F + +QVNL+G F Sbjct: 58 VSSPDSAEAAINAAREAHGPCGIAVNCAGIATASKILGREGVMPLENFSKVIQVNLIGTF 117 Query: 118 LCAREFSRLMIR-----DGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDL 172 R + M + DG +G II S + G + YSA+K G V LT A +L Sbjct: 118 NILRLAAADMAQREPNADGERGVIINTASVAAYEGQIGQAAYSASKGGVVSLTLQSAREL 177 Query: 173 AEYGITVHSLMLGNLLKSPMFQSL-----------LPQYATKLGIPEE 209 A GI V+++ G L +PM + LP + +LG PEE Sbjct: 178 AREGIRVNTIAPG-LFMTPMMAGMPEEVQESLAATLP-FPKRLGKPEE 223 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 253 Length adjustment: 24 Effective length of query: 235 Effective length of database: 229 Effective search space: 53815 Effective search space used: 53815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory